🌎 Spedisci a: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS / CoA struttura Massivo e personalizzato
Menu
Account
Impostazioni
྾
340,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

CHST3

DescrizioneCarbohydrate sulfotransferase 3

Gene and Protein Information

Gene ID9469
Uniprot Accession IDs Q7LGC8 O75099 Q52M30
Ensembl ID ENSP00000362207
Symbol HSD C6ST C6ST1
FamilyBelongs to the sulfotransferase 1 family. Gal/GlcNAc/GalNAc subfamily.
Sequence
MEKGLTLPQDCRDFVHSLKMRSKYALFLVFVVIVFVFIEKENKIISRVSDKLKQIPQALADANSTDPALILAENASLLSLSELDSAFSQLQSRLRNLSLQLGVEPAMEAAGEEEEEQRKEEEPPRPAVAGPRRHVLLMATTRTGSSFVGEFFNQQGNIFYLFEPLWHIERTVSFEPGGANAAGSALVYRDVLKQLFLCDLYVLEHFITPLPEDHLTQFMFRRGSSRSLCEDPVCTPFVKKVFEKYHCKNRRCGPLNVTLAAEACRRKEHMALKAVRIRQLEFLQPLAEDPRLDLRVIQLVRDPRAVLASRMVAFAGKYKTWKKWLDDEGQDGLREEEVQRLRGNCESIRLSAELGLRQPAWLRGRYMLVRYEDVARGPLQKAREMYRFAGIPLTPQVEDWIQKNTQAAHDGSGIYSTQKNSSEQFEKWRFSMPFKLAQVVQAACGPAMRLFGYKLARDAAALTNRSVSLLEERGTFWVT
Mostra altro
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp466290CHST3carbohydrate sulfotransferase 39598VGNC:12282OMA, EggNOG
Mouse53374Chst3carbohydrate (chondroitin 6/keratan) sulfotransferase 310090MGI:1858224Inparanoid, OMA, EggNOG
Rat84468Chst3carbohydrate sulfotransferase 310116RGD:620355Inparanoid, OMA, EggNOG
Dog100855759CHST3carbohydrate sulfotransferase 39615VGNC:39255Inparanoid, OMA, EggNOG
Horse100063554CHST3carbohydrate sulfotransferase 39796VGNC:16537Inparanoid, OMA, EggNOG
Cow506758CHST3carbohydrate sulfotransferase 39913VGNC:27345Inparanoid, OMA, EggNOG
Pig100151968CHST3carbohydrate sulfotransferase 39823Inparanoid, OMA, EggNOG
Opossum100010061CHST3carbohydrate sulfotransferase 313616Inparanoid, OMA, EggNOG
Chicken396018CHST3carbohydrate sulfotransferase 39031CGNC:49608Inparanoid, OMA
Anole lizard100568098chst3carbohydrate sulfotransferase 328377Inparanoid, OMA, EggNOG
Xenopus100492673chst3carbohydrate (chondroitin 6) sulfotransferase 38364XB-GENE-993289OMA, EggNOG
Zebrafish559721chst3acarbohydrate (chondroitin 6) sulfotransferase 3a7955ZDB-GENE-090312-180Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificheSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Utilizziamo i cookie per garantire il corretto funzionamento del sito web e, ove consentito, per migliorare la tua esperienza. Puoi gestire le tue preferenze in qualsiasi momento nelle Impostazioni. Per saperne di più, consulta la nostra Cookie Policy.

      Desidera che le inviamo un messaggio quando avremo sconti disponibili?

      Ricordamelo più tardi

      Grazie! Controlli la sua casella di posta per confermare.

      Ops! Le notifiche sono disabilitate.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.