🌎 Spedisci a: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS / CoA struttura Massivo e personalizzato
Menu
Account
Impostazioni
྾
340,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

ARPC5L

DescrizioneActin-related protein 2/3 complex subunit 5-like protein

Gene and Protein Information

Gene ID81873
Uniprot Accession IDs Q9BPX5 Q7Z523
Ensembl ID ENSP00000345361
Symbol ARC16-2
FamilyBelongs to the ARPC5 family.
Sequence
MARNTLSSRFRRVDIDEFDENKFVDEQEEAAAAAAEPGPDPSEVDGLLRQGDMLRAFHAALRNSPVNTKNQAVKERAQGVVLKVLTNFKSSEIEQAVQSLDRNGVDLLMKYIYKGFEKPTENSSAVLLQWHEKALAVGGLGSIIRVLTARKTV
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp739553ARPC5Lactin related protein 2/3 complex subunit 5 like9598VGNC:13853OMA, EggNOG
Mouse74192Arpc5lactin related protein 2/3 complex, subunit 5-like10090MGI:1921442Inparanoid, OMA, EggNOG
Rat296710Arpc5lactin related protein 2/3 complex, subunit 5-like10116RGD:1308867Inparanoid, OMA, EggNOG
Dog612856ARPC5Lactin related protein 2/3 complex subunit 5 like9615VGNC:38132Inparanoid, OMA, EggNOG
Horse100067289ARPC5Lactin related protein 2/3 complex subunit 5 like9796VGNC:15540Inparanoid, OMA, EggNOG
Cow613421ARPC5Lactin related protein 2/3 complex subunit 5 like9913VGNC:26166Inparanoid, OMA, EggNOG
Pig100154462ARPC5Lactin related protein 2/3 complex subunit 5 like9823OMA, EggNOG
Opossum100015743ARPC5Lactin related protein 2/3 complex subunit 5 like13616Inparanoid, EggNOG
Platypus100078118ARPC5Lactin related protein 2/3 complex subunit 5 like9258OMA, EggNOG
Chicken101752218ARPC5Lactin related protein 2/3 complex subunit 5 like9031CGNC:71626OMA, EggNOG
Anole lizard100556158LOC100556158actin-related protein 2/3 complex subunit 5-like protein28377OMA, EggNOG
Xenopus734053arpc5lactin related protein 2/3 complex subunit 5-like8364XB-GENE-490524Inparanoid, OMA, EggNOG
Zebrafish393550arpc5laactin related protein 2/3 complex, subunit 5-like, a7955ZDB-GENE-040426-1453OMA, EggNOG
C. elegans171882arx-7Actin-related protein 2/3 complex subunit 56239OMA, EggNOG
C. elegans183522C46H11.3Probable actin-related protein 2/3 complex subunit 56239Inparanoid, OMA
S.cerevisiae854748ARC15Arc15p4932S000001324OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    cytoskeletal protein    /    actin family cytoskeletal protein    /    Actin-related protein 2/3 complex subunit 5-like protein
DTO Classes
protein    /    Cellular structure    /    Actin family cytoskeletal protein    /    Actin-related protein 2/3 complex subunit 5-like protein

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Utilizziamo i cookie per garantire il corretto funzionamento del sito web e, ove consentito, per migliorare la tua esperienza. Puoi gestire le tue preferenze in qualsiasi momento nelle Impostazioni. Per saperne di più, consulta la nostra Cookie Policy.

      Desidera che le inviamo un messaggio quando avremo sconti disponibili?

      Ricordamelo più tardi

      Grazie! Controlli la sua casella di posta per confermare.

      Ops! Le notifiche sono disabilitate.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.