ARL17A

DescrizioneADP-ribosylation factor-like protein 17

Gene and Protein Information

Gene ID100506084
Uniprot Accession IDs Q8IVW1 B0AZR6 Q59FW5 Q8N6E2 Q8TD73 Q8WW54 Q9NZD5 Q9P158
Ensembl ID ENSP00000404247
Symbol ARL17P1 ARL17 ARL17A
FamilyBelongs to the small GTPase superfamily. Arf family.
Sequence
MGNIFEKLFKSLLGKKKMRILILSLDTAGKTTILYKLKLGETVPAVPTVGFCVETVEYKNNTFAVWDVGSHFKIRPLWQHFFQNTKGARSPGSTHQGSLASGVLPIKCSHVEFGMWKGGRSHPFLPHSSRCAGSGGQLDSILPHQSPAWGPWGCKDLSSGFPSFLTSSILWKSAVVK

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.