🌎 Spedisci a: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS / CoA struttura Massivo e personalizzato
Menu
Account
Impostazioni
྾
340,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

EEF1G

DescrizioneElongation factor 1-gamma

Gene and Protein Information

Gene ID1937
Uniprot Accession IDs P26641 B4DTG2 Q6PJ62 Q6PK31 Q96CU2 Q9P196 EF-1-gamma
Ensembl ID ENSP00000331901
Symbol EF1G EF1G GIG35
Sequence
MAAGTLYTYPENWRAFKALIAAQYSGAQVRVLSAPPHFHFGQTNRTPEFLRKFPAGKVPAFEGDDGFCVFESNAIAYYVSNEELRGSTPEAAAQVVQWVSFADSDIVPPASTWVFPTLGIMHHNKQATENAKEEVRRILGLLDAYLKTRTFLVGERVTLADITVVCTLLWLYKQVLEPSFRQAFPNTNRWFLTCINQPQFRAVLGEVKLCEKMAQFDAKKFAETQPKKDTPRKEKGSREEKQKPQAERKEEKKAAAPAPEEEMDECEQALAAEPKAKDPFAHLPKSTFVLDEFKRKYSNEDTLSVALPYFWEHFDKDGWSLWYSEYRFPEELTQTFMSCNLITGMFQRLDKLRKNAFASVILFGTNNSSSISGVWVFRGQELAFPLSPDWQVDYESYTWRKLDPGSEETQTLVREYFSWEGAFQHVGKAFNQGKIFK
Mostra altro
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp451253EEF1Geukaryotic translation elongation factor 1 gamma9598VGNC:11344OMA, EggNOG
Macaque722274EEF1Geukaryotic translation elongation factor 1 gamma9544OMA, EggNOG
Mouse67160Eef1geukaryotic translation elongation factor 1 gamma10090MGI:1914410Inparanoid, OMA, EggNOG
Rat293725Eef1geukaryotic translation elongation factor 1 gamma10116RGD:1302939Inparanoid, OMA, EggNOG
Dog611396EEF1Geukaryotic translation elongation factor 1 gamma9615Inparanoid, OMA, EggNOG
Horse100009686EEF1Geukaryotic translation elongation factor 1 gamma9796VGNC:17431Inparanoid, OMA, EggNOG
Cow326581EEF1Geukaryotic translation elongation factor 1 gamma9913VGNC:28334Inparanoid, OMA, EggNOG
Pig397022EEF1Geukaryotic translation elongation factor 1 gamma9823Inparanoid, OMA, EggNOG
Opossum100011874EEF1Geukaryotic translation elongation factor 1 gamma13616OMA, EggNOG
Xenopus394875eef1geukaryotic translation elongation factor 1 gamma8364XB-GENE-975013Inparanoid, OMA, EggNOG
Zebrafish195822eef1geukaryotic translation elongation factor 1 gamma7955ZDB-GENE-020423-3Inparanoid, OMA
Fruitfly44791Ef1gammaCG11901 gene product from transcript CG11901-RC7227FBgn0029176Inparanoid, EggNOG
S.cerevisiae856059CAM1translation elongation factor EF1B gamma4932S000005969OMA, EggNOG

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificheSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Utilizziamo i cookie per garantire il corretto funzionamento del sito web e, ove consentito, per migliorare la tua esperienza. Puoi gestire le tue preferenze in qualsiasi momento nelle Impostazioni. Per saperne di più, consulta la nostra Cookie Policy.

      Desidera che le inviamo un messaggio quando avremo sconti disponibili?

      Ricordamelo più tardi

      Grazie! Controlli la sua casella di posta per confermare.

      Ops! Le notifiche sono disabilitate.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.