🌎 Ship to: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS / CoA Structure Massivo e personalizzato
Menu
Account
Impostazioni
྾
224,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

IRF9

DescrizioneInterferon regulatory factor 9

Gene and Protein Information

Gene ID10379
Uniprot Accession IDs Q00978 D3DS61 IRF-9
Ensembl ID ENSP00000380073
Symbol ISGF3G p48 IRF-9 ISGF3 ISGF3G
FamilyBelongs to the IRF family.
Sequence
MASGRARCTRKLRNWVVEQVESGQFPGVCWDDTAKTMFRIPWKHAGKQDFREDQDAAFFKAWAIFKGKYKEGDTGGPAVWKTRLRCALNKSSEFKEVPERGRMDVAEPYKVYQLLPPGIVSGQPGTQKVPSKRQHSSVSSERKEEEDAMQNCTLSPSVLQDSLNNEEEGASGGAVHSDIGSSSSSSSPEPQEVTDTTEAPFQGDQRSLEFLLPPEPDYSLLLTFIYNGRVVGEAQVQSLDCRLVAEPSGSESSMEQVLFPKPGPLEPTQRLLSQLERGILVASNPRGLFVQRLCPIPISWNAPQAPPGPGPHLLPSNECVELFRTAYFCRDLVRYFQGLGPPPKFQVTLNFWEESHGSSHTPQNLITVKMEQAFARYLLEQTPEQQAAILSLV
Mostra altro
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp744767IRF9interferon regulatory factor 99598VGNC:3391OMA, EggNOG
Mouse16391Irf9interferon regulatory factor 910090MGI:107587Inparanoid, OMA, EggNOG
Rat305896Irf9interferon regulatory factor 910116RGD:1308766Inparanoid, OMA, EggNOG
Dog607899IRF9interferon regulatory factor 99615VGNC:42097Inparanoid, OMA, EggNOG
Horse100051589IRF9interferon regulatory factor 99796VGNC:19139Inparanoid, OMA, EggNOG
Cow509855IRF9interferon regulatory factor 99913VGNC:30280OMA, EggNOG
Pig780415IRF9interferon regulatory factor 99823OMA, EggNOG
OpossumIRF9interferon regulatory factor 9 [Source:HGNC Symbol;Acc:HGNC:6131]13616Inparanoid, EggNOG
Anole lizard103282032LOC103282032interferon regulatory factor 928377OMA, EggNOG

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.