🌎 Ship to: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS / CoA Structure Massivo e personalizzato
Menu
Account
Impostazioni
྾
224,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

GOLPH3

DescrizioneGolgi phosphoprotein 3

Gene and Protein Information

Gene ID64083
Uniprot Accession IDs Q9H4A6 Q9UIW5
Ensembl ID ENSP00000265070
Symbol GPP34 GOPP1 GPP34 MIDAS Vps74
FamilyBelongs to the GOLPH3/VPS74 family.
Sequence
MTSLTQRSSGLVQRRTEASRNAADKERAAGGGAGSSEDDAQSRRDEQDDDDKGDSKETRLTLMEEVLLLGLKDREGYTSFWNDCISSGLRGCMLIELALRGRLQLEACGMRRKSLLTRKVICKSDAPTGDVLLDEALKHVKETQPPETVQNWIELLSGETWNPLKLHYQLRNVRERLAKNLVEKGVLTTEKQNFLLFDMTTHPLTNNNIKQRLIKKVQEAVLDKWVNDPHRMDRRLLALIYLAHASDVLENAFAPLLDEQYDLATKRVRQLLDLDPEVECLKANTNEVLWAVVAAFTK
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp461946GOLPH3golgi phosphoprotein 39598VGNC:6929OMA, EggNOG
Macaque700428GOLPH3golgi phosphoprotein 39544Inparanoid, OMA, EggNOG
Mouse66629Golph3golgi phosphoprotein 310090MGI:1913879Inparanoid, OMA, EggNOG
Rat78961Golph3golgi phosphoprotein 310116RGD:621226Inparanoid, OMA, EggNOG
Dog489241GOLPH3golgi phosphoprotein 39615VGNC:49691Inparanoid, OMA, EggNOG
Horse100068637GOLPH3golgi phosphoprotein 39796VGNC:18458Inparanoid, OMA, EggNOG
Cow531359GOLPH3golgi phosphoprotein 39913VGNC:29492Inparanoid, OMA, EggNOG
Opossum100015793GOLPH3golgi phosphoprotein 313616Inparanoid, OMA, EggNOG
Chicken427422GOLPH3golgi phosphoprotein 39031CGNC:53081Inparanoid, OMA
Anole lizard100559943golph3golgi phosphoprotein 328377Inparanoid, OMA
Zebrafish561662si:dkey-27b3.2si:dkey-27b3.27955ZDB-GENE-091117-10Inparanoid, OMA
S.cerevisiae851978VPS74Vps74p4932S000002780Inparanoid, OMA

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.