🌎 Ship to: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS / CoA Structure Massivo e personalizzato
Menu
Account
Impostazioni
྾
224,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

INHA

DescrizioneInhibin alpha chain

Gene and Protein Information

Gene ID3623
Uniprot Accession IDs P05111 A8K8H5
Ensembl ID ENSP00000243786
FamilyBelongs to the TGF-beta family.
Sequence
MVLHLLLFLLLTPQGGHSCQGLELARELVLAKVRALFLDALGPPAVTREGGDPGVRRLPRRHALGGFTHRGSEPEEEEDVSQAILFPATDASCEDKSAARGLAQEAEEGLFRYMFRPSQHTRSRQVTSAQLWFHTGLDRQGTAASNSSEPLLGLLALSPGGPVAVPMSLGHAPPHWAVLHLATSALSLLTHPVLVLLLRCPLCTCSARPEATPFLVAHTRTRPPSGGERARRSTPLMSWPWSPSALRLLQRPPEEPAAHANCHRVALNISFQELGWERWIVYPPSFIFHYCHGGCGLHIPPNLSLPVPGAPPTPAQPYSLLPGAQPCCAALPGTMRPLHVRTTSDGGYSFKYETVPNLLTQHCACI
Mostra altro
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp743866INHAinhibin subunit alpha9598VGNC:1976OMA, EggNOG
Macaque574379INHAinhibin alpha subunit9544Inparanoid, OMA, EggNOG
Mouse16322Inhainhibin alpha10090MGI:96569Inparanoid, OMA, EggNOG
Rat24504Inhainhibin alpha subunit10116RGD:2912Inparanoid, OMA, EggNOG
Dog488540INHAinhibin subunit alpha9615VGNC:42020Inparanoid, OMA, EggNOG
Horse100034077INHAinhibin alpha9796Inparanoid, EggNOG
Cow281254INHAinhibin subunit alpha9913VGNC:30199Inparanoid, OMA, EggNOG
Pig397386INHAinhibin alpha subunit9823Inparanoid, OMA, EggNOG
Opossum100009806INHAinhibin alpha subunit13616Inparanoid, OMA, EggNOG
Chicken424197INHAinhibin alpha subunit9031CGNC:8534Inparanoid, OMA, EggNOG
Anole lizard100561289inhainhibin alpha subunit28377Inparanoid, OMA, EggNOG
Xenopus613114inhainhibin subunit alpha8364XB-GENE-853910Inparanoid, OMA, EggNOG
Zebrafish570520inhainhibin subunit alpha7955ZDB-GENE-060503-554Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    signaling molecule    /    growth factor    /    Inhibin alpha chain
DTO Classes
protein    /    Signaling    /    Growth factor    /    Inhibin alpha chain

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.