🌎 Spedisci a: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS / CoA struttura Massivo e personalizzato
Menu
Account
Impostazioni
྾
340,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

KCNK13

DescrizionePotassium channel subfamily K member 13

Gene and Protein Information

Gene ID56659
Uniprot Accession IDs Q9HB14 B5TJL8 Q96E79
Ensembl ID ENSP00000282146
Symbol THIK1 THIK-1 K2p13.1
FamilyBelongs to the two pore domain potassium channel (TC 1.A.1.8) family.
Sequence
MAGRGFSWGPGHLNEDNARFLLLAALIVLYLLGGAAVFSALELAHERQAKQRWEERLANFSRGHNLSRDELRGFLRHYEEATRAGIRVDNVRPRWDFTGAFYFVGTVVSTIGFGMTTPATVGGKIFLIFYGLVGCSSTILFFNLFLERLITIIAYIMKSCHQRQLRRRGALPQESLKDAGQCEVDSLAGWKPSVYYVMLILCTASILISCCASAMYTPIEGWSYFDSLYFCFVAFSTIGFGDLVSSQNAHYESQGLYRFANFVFILMGVCCIYSLFNVISILIKQSLNWILRKMDSGCCPQCQRGLLRSRRNVVMPGSVRNRCNISIETDGVAESDTDGRRLSGEMISMKDLLAANKASLAILQKQLSEMANGCPHQTSTLARDNEFSGGVGAFAIMNNRLAETSGDR
Mostra altro
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp737631KCNK13potassium two pore domain channel subfamily K member 139598VGNC:7445OMA, EggNOG
MacaqueKCNK13potassium two pore domain channel subfamily K member 13 [Source:HGNC Symbol;Acc:HGNC:6275]9544Inparanoid, OMA, EggNOG
Mouse217826Kcnk13potassium channel, subfamily K, member 1310090MGI:2384976Inparanoid, OMA, EggNOG
Rat64120Kcnk13potassium two pore domain channel subfamily K member 1310116RGD:68941Inparanoid, OMA, EggNOG
Dog490829KCNK13potassium two pore domain channel subfamily K member 139615VGNC:53499Inparanoid, OMA
HorseKCNK13potassium two pore domain channel subfamily K member 13 [Source:HGNC Symbol;Acc:HGNC:6275]9796OMA, EggNOG
Pig100623906KCNK13potassium two pore domain channel subfamily K member 139823Inparanoid, OMA, EggNOG
Opossum100018915KCNK13potassium two pore domain channel subfamily K member 1313616Inparanoid, EggNOG
Chicken772210KCNK13potassium two pore domain channel subfamily K member 139031CGNC:8108Inparanoid, OMA, EggNOG
Anole lizard100562988kcnk13potassium two pore domain channel subfamily K member 1328377Inparanoid, OMA
Zebrafish571467kcnk13apotassium channel, subfamily K, member 13a7955ZDB-GENE-080219-46OMA, EggNOG
Zebrafish556073kcnk13bpotassium channel, subfamily K, member 13b7955ZDB-GENE-040724-105Inparanoid, OMA
C. elegans179699twk-14TWiK family of potassium channels6239OMA, EggNOG

Protein Classes

DTO Classes
protein    /    Ion channel    /    Two pore domain potassium channel family    /    Potassium channel subfamily k member 13

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificheSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Utilizziamo i cookie per garantire il corretto funzionamento del sito web e, ove consentito, per migliorare la tua esperienza. Puoi gestire le tue preferenze in qualsiasi momento nelle Impostazioni. Per saperne di più, consulta la nostra Cookie Policy.

      Desidera che le inviamo un messaggio quando avremo sconti disponibili?

      Ricordamelo più tardi

      Grazie! Controlli la sua casella di posta per confermare.

      Ops! Le notifiche sono disabilitate.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.