GSTO1

DescrizioneGlutathione S-transferase omega-1

Gene and Protein Information

Gene ID9446
Uniprot Accession IDs P78417 D3DRA3 F5H7H0 Q5TA03 Q7Z3T2 GSTO-1
Ensembl ID ENSP00000358727
Symbol GSTTLP28 P28 SPG-R GSTO 1-1 GSTTLp28 HEL-S-21
FamilyBelongs to the GST superfamily. Omega family.
Sequence
MSGESARSLGKGSAPPGPVPEGSIRIYSMRFCPFAERTRLVLKAKGIRHEVININLKNKPEWFFKKNPFGLVPVLENSQGQLIYESAITCEYLDEAYPGKKLLPDDPYEKACQKMILELFSKVPSLVGSFIRSQNKEDYAGLKEEFRKEFTKLEEVLTNKKTTFFGGNSISMIDYLIWPWFERLEAMKLNECVDHTPKLKLWMAAMKEDPTVSALLTSEKDWQGFLELYLQNSPEACDYGL
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp450719GSTO1glutathione S-transferase omega 19598VGNC:12340Inparanoid, OMA, EggNOG
Macaque716078GSTO1glutathione S-transferase omega 19544Inparanoid, OMA, EggNOG
Mouse14873Gsto1glutathione S-transferase omega 110090MGI:1342273Inparanoid, OMA, EggNOG
Rat114846Gsto1glutathione S-transferase omega 110116RGD:70952Inparanoid, OMA, EggNOG
Dog477813GSTO1glutathione S-transferase omega 19615VGNC:41536Inparanoid, OMA
Horse100069640GSTO1glutathione S-transferase omega 19796VGNC:18628Inparanoid, OMA
Cow785216GSTO1glutathione S-transferase omega 19913Inparanoid, OMA
Pig397117GSTO1glutathione S-transferase omega 19823Inparanoid, OMA
Chicken423881GSTO1glutathione S-transferase omega 19031CGNC:52072Inparanoid, OMA

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.