🌎 Ship to: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS / CoA Structure Massivo e personalizzato
Menu
Account
Impostazioni
྾
224,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

IMPA1

DescrizioneInositol monophosphatase 1

Gene and Protein Information

Gene ID3612
Uniprot Accession IDs P29218 B2R733 B4DLN3 B7Z6Q4 J3KQT7 Q9UK71 IMP 1
Ensembl ID ENSP00000408526
Symbol IMPA IMP IMPA MRT59
FamilyBelongs to the inositol monophosphatase superfamily.
Sequence
MADPWQECMDYAVTLARQAGEVVCEAIKNEMNVMLKSSPVDLVTATDQKVEKMLISSIKEKYPSHSFIGEESVAAGEKSILTDNPTWIIDPIDGTTNFVHRFPFVAVSIGFAVNKKIEFGVVYSCVEGKMYTARKGKGAFCNGQKLQVSQQEDITKSLLVTELGSSRTPETVRMVLSNMEKLFCIPVHGIRSVGTAAVNMCLVATGGADAYYEMGIHCWDVAGAGIIVTEAGGVLMDVTGGPFDLMSRRVIAANNRILAERIAKEIQVIPLQRDDED
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp100613673IMPA1inositol monophosphatase 19598VGNC:12290OMA, EggNOG
Macaque701959IMPA1inositol monophosphatase 19544Inparanoid, OMA, EggNOG
Mouse55980Impa1inositol (myo)-1(or 4)-monophosphatase 110090MGI:1933158Inparanoid, OMA, EggNOG
Rat83523Impa1inositol monophosphatase 110116RGD:69254Inparanoid, OMA, EggNOG
Dog477925IMPA1inositol monophosphatase 19615VGNC:42007Inparanoid, OMA, EggNOG
Horse100050326IMPA1inositol monophosphatase 19796VGNC:19049Inparanoid, OMA, EggNOG
Cow281865IMPA1inositol monophosphatase 19913VGNC:30184Inparanoid, OMA, EggNOG
Pig397425IMPA1inositol monophosphatase 19823Inparanoid, EggNOG
Opossum100019291IMPA1inositol monophosphatase 113616Inparanoid, OMA, EggNOG
Anole lizard100554351impa1inositol monophosphatase 128377Inparanoid, OMA
Xenopus549811impa1inositol(myo)-1(or 4)-monophosphatase 18364XB-GENE-1004318Inparanoid, OMA

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.