Il negozio non funziona correttamente quando i cookie sono disabilitati.
I JavaScript sembrano essere disabilitati nel tuo browser. Per una migliore esperienza sul nostro sito, assicurati di attivare i javascript nel tuo browser.
224,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino
FABP1 Descrizione Fatty acid-binding protein, liver
Gene and Protein Information Gene ID 2168 Uniprot Accession IDs P07148 Ensembl ID ENSP00000295834 Symbol FABPL FABPL L-FABP Family Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family. Sequence MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI
Homologous gene and protein info.
Species Gene ID Gene Symbol Nome Codice fiscale Other Gene ID Sorgenti Chimp 736471 FABP1 fatty acid binding protein 1 9598 VGNC:7696 OMA, EggNOG Mouse 14080 Fabp1 fatty acid binding protein 1, liver 10090 MGI:95479 Inparanoid, OMA, EggNOG Rat 24360 Fabp1 fatty acid binding protein 1 10116 RGD:2590 Inparanoid, OMA, EggNOG Dog 403619 FABP1 fatty acid binding protein 1 9615 VGNC:40558 Inparanoid, OMA, EggNOG Horse 100052746 FABP1 fatty acid binding protein 1 9796 VGNC:17765 Inparanoid, OMA, EggNOG Cow 327700 FABP1 fatty acid binding protein 1 9913 VGNC:28695 Inparanoid, OMA, EggNOG Pig 445535 FABP1 fatty acid binding protein 1 9823 Inparanoid, OMA, EggNOG Opossum FABP1 fatty acid binding protein 1 [Source:HGNC Symbol;Acc:HGNC:3555] 13616 Inparanoid, EggNOG Platypus FABP1 fatty acid binding protein 1 [Source:HGNC Symbol;Acc:HGNC:3555] 9258 OMA, EggNOG Chicken 374015 FABP1 fatty acid binding protein 1 9031 CGNC:11895 OMA, EggNOG Anole lizard 100562032 fabp1 fatty acid binding protein 1 28377 Inparanoid, OMA, EggNOG Xenopus 100144636 fabp1 fatty acid binding protein 1 8364 XB-GENE-481608 Inparanoid, OMA, EggNOG Zebrafish 791610 fabp1a fatty acid binding protein 1a, liver 7955 ZDB-GENE-020318-3 Inparanoid, OMA
Associated Recombinant Proteins Nome Specification and purity Expression system Protein label Disponibilità Vedi dettagli
Associated Antibodies
Nome Specifications Species reactivity Applicazione Disponibilità Vedi dettagli
Associated Approved Drugs Associated Active Ligands Associated Diseases Nome Direct Associated Targets Disease Type Mondoid
We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our
Cookie Policy. Impostazioni Accetto tutto Decline
Shall we send you a message when we have discounts available?
Remind me later Permetti
Thank you! Please check your email inbox to confirm.
Oops! Notifications are disabled.
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.