FABP1

DescrizioneFatty acid-binding protein, liver

Gene and Protein Information

Gene ID2168
Uniprot Accession IDs P07148
Ensembl ID ENSP00000295834
Symbol FABPL FABPL L-FABP
FamilyBelongs to the calycin superfamily. Fatty-acid binding protein (FABP) family.
Sequence
MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp736471FABP1fatty acid binding protein 19598VGNC:7696OMA, EggNOG
Mouse14080Fabp1fatty acid binding protein 1, liver10090MGI:95479Inparanoid, OMA, EggNOG
Rat24360Fabp1fatty acid binding protein 110116RGD:2590Inparanoid, OMA, EggNOG
Dog403619FABP1fatty acid binding protein 19615VGNC:40558Inparanoid, OMA, EggNOG
Horse100052746FABP1fatty acid binding protein 19796VGNC:17765Inparanoid, OMA, EggNOG
Cow327700FABP1fatty acid binding protein 19913VGNC:28695Inparanoid, OMA, EggNOG
Pig445535FABP1fatty acid binding protein 19823Inparanoid, OMA, EggNOG
OpossumFABP1fatty acid binding protein 1 [Source:HGNC Symbol;Acc:HGNC:3555]13616Inparanoid, EggNOG
PlatypusFABP1fatty acid binding protein 1 [Source:HGNC Symbol;Acc:HGNC:3555]9258OMA, EggNOG
Chicken374015FABP1fatty acid binding protein 19031CGNC:11895OMA, EggNOG
Anole lizard100562032fabp1fatty acid binding protein 128377Inparanoid, OMA, EggNOG
Xenopus100144636fabp1fatty acid binding protein 18364XB-GENE-481608Inparanoid, OMA, EggNOG
Zebrafish791610fabp1afatty acid binding protein 1a, liver7955ZDB-GENE-020318-3Inparanoid, OMA

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.