🌎 Spedisci a: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS / CoA struttura Massivo e personalizzato
Menu
Account
Impostazioni
྾
340,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

FTCD

DescrizioneFormimidoyltransferase-cyclodeaminase

Gene and Protein Information

Gene ID10841
Uniprot Accession IDs O95954 B9EGD0 Q86V03 Q9HCT4 Q9HCT5 Q9HCT6 Q9UHJ2
Ensembl ID ENSP00000291670
Symbol LCHC1
FamilyIn the N-terminal section; belongs to the formiminotransferase family.
Sequence
MSQLVECVPNFSEGKNQEVIDAISGAITQTPGCVLLDVDAGPSTNRTVYTFVGPPECVVEGALNAARVASRLIDMSRHQGEHPRMGALDVCPFIPVRGVSVDECVLCAQAFGQRLAEELDVPVYLYGEAARMDSRRTLPAIRAGEYEALPKKLQQADWAPDFGPSSFVPSWGATATGARKFLIAFNINLLGTKEQAHRIALNLREQGRGKDQPGRLKKVQGIGWYLDEKNLAQVSTNLLDFEVTALHTVYEETCREAQELSLPVVGSQLVGLVPLKALLDAAAFYCEKENLFILEEEQRIRLVVSRLGLDSLCPFSPKERIIEYLVPERGPERGLGSKSLRAFVGEVGARSAAPGGGSVAAAAAAMGAALGSMVGLMTYGRRQFQSLDTTMRRLIPPFREASAKLTTLVDADAEAFTAYLEAMRLPKNTPEEKDRRTAALQEGLRRAVSVPLTLAETVASLWPALQELARCGNLACRSDLQVAAKALEMGVFGAYFNVLINLRDITDEAFKDQIHHRVSSLLQEAKTQAALVLDCLETRQE
Mostra altro
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Macaque721818FTCDformimidoyltransferase cyclodeaminase9544OMA, EggNOG
Mouse14317Ftcdformiminotransferase cyclodeaminase10090MGI:1339962Inparanoid, OMA, EggNOG
Rat89833Ftcdformimidoyltransferase cyclodeaminase10116RGD:70915Inparanoid, OMA, EggNOG
Dog607685FTCDformimidoyltransferase cyclodeaminase9615VGNC:41002Inparanoid, OMA, EggNOG
Horse100049972FTCDformimidoyltransferase cyclodeaminase9796VGNC:18148Inparanoid, OMA, EggNOG
Cow535816FTCDformimidoyltransferase cyclodeaminase9913VGNC:29137Inparanoid, OMA, EggNOG
Pig397517FTCDformimidoyltransferase cyclodeaminase9823Inparanoid, OMA, EggNOG
Chicken395726FTCDformimidoyltransferase cyclodeaminase9031CGNC:4601Inparanoid, OMA, EggNOG
Anole lizard100558718ftcdformimidoyltransferase cyclodeaminase28377OMA, EggNOG
Xenopus448617ftcdformimidoyltransferase cyclodeaminase8364XB-GENE-963745Inparanoid, OMA, EggNOG
Zebrafish394052ftcdformimidoyltransferase cyclodeaminase7955ZDB-GENE-030131-9643Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    hydrolase    /    deaminase    /    Formimidoyltransferase-cyclodeaminase
protein    /    hydrolase    /    transferase    /    Formimidoyltransferase-cyclodeaminase
DTO Classes
protein    /    Enzyme    /    Hydrolase    /    Deaminase    /    Formimidoyltransferase-cyclodeaminase

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificheSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Utilizziamo i cookie per garantire il corretto funzionamento del sito web e, ove consentito, per migliorare la tua esperienza. Puoi gestire le tue preferenze in qualsiasi momento nelle Impostazioni. Per saperne di più, consulta la nostra Cookie Policy.

      Desidera che le inviamo un messaggio quando avremo sconti disponibili?

      Ricordamelo più tardi

      Grazie! Controlli la sua casella di posta per confermare.

      Ops! Le notifiche sono disabilitate.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.