🌎 Ship to: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS / CoA Structure Massivo e personalizzato
Menu
Account
Impostazioni
྾
224,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

IGFBP6

DescrizioneInsulin-like growth factor-binding protein 6

Gene and Protein Information

Gene ID3489
Uniprot Accession IDs P24592 Q14492 IBP-6
Ensembl ID ENSP00000301464
Symbol IBP6 IBP6
Sequence
MTPHRLLPPLLLLLALLLAASPGGALARCPGCGQGVQAGCPGGCVEEEDGGSPAEGCAEAEGCLRREGQECGVYTPNCAPGLQCHPPKDDEAPLRALLLGRGRCLPARAPAVAEENPKESKPQAGTARPQDVNRRDQQRNPGTSTTPSQPNSAGVQDTEMGPCRRHLDSVLQQLQTEVYRGAQTLYVPNCDHRGFYRKRQCRSSQGQRRGPCWCVDRMGKSLPGSPDGNGSSSCPTGSSG
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp451929IGFBP6insulin like growth factor binding protein 69598VGNC:5428OMA, EggNOG
Mouse16012Igfbp6insulin-like growth factor binding protein 610090MGI:96441Inparanoid, OMA, EggNOG
Rat25641Igfbp6insulin-like growth factor binding protein 610116RGD:2877Inparanoid, OMA, EggNOG
Dog607374IGFBP6insulin like growth factor binding protein 69615VGNC:41907Inparanoid, OMA, EggNOG
Horse100034156IGFBP6insulin like growth factor binding protein 69796VGNC:18975Inparanoid, OMA, EggNOG
Cow404186IGFBP6insulin like growth factor binding protein 69913VGNC:30088Inparanoid, OMA, EggNOG
Pig100101923IGFBP6insulin like growth factor binding protein 69823Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.