🌎 Ship to: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS / CoA Structure Massivo e personalizzato
Menu
Account
Impostazioni
྾
224,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

PAX8

DescrizionePaired box protein Pax-8

Gene and Protein Information

Gene ID7849
Uniprot Accession IDs Q06710 Q09155 Q16337 Q16338 Q16339 Q4ZG35 Q96J49
Ensembl ID ENSP00000263334
Sequence
MPHNSIRSGHGGLNQLGGAFVNGRPLPEVVRQRIVDLAHQGVRPCDISRQLRVSHGCVSKILGRYYETGSIRPGVIGGSKPKVATPKVVEKIGDYKRQNPTMFAWEIRDRLLAEGVCDNDTVPSVSSINRIIRTKVQQPFNLPMDSCVATKSLSPGHTLIPSSAVTPPESPQSDSLGSTYSINGLLGIAQPGSDKRKMDDSDQDSCRLSIDSQSSSSGPRKHLRTDAFSQHHLEPLECPFERQHYPEAYASPSHTKGEQGLYPLPLLNSTLDDGKATLTPSNTPLGRNLSTHQTYPVVADPHSPFAIKQETPEVSSSSSTPSSLSSSAFLDLQQVGSGVPPFNAFPHAASVYGQFTGQALLSGREMVGPTLPGYPPHIPTSGQGSYASSAIAGMVAGSEYSGNAYGHTPYSSYSEAWRFPNSSLLSSPYYYSSTSRPSAPPTTATAFDHL
Mostra altro
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp459503PAX8paired box 89598VGNC:10736OMA, EggNOG
Macaque701906PAX8paired box 89544Inparanoid, OMA, EggNOG
Mouse18510Pax8paired box 810090MGI:97492Inparanoid, OMA, EggNOG
Rat81819Pax8paired box 810116RGD:620434Inparanoid, OMA, EggNOG
Dog403927PAX8paired box 89615VGNC:44279Inparanoid, OMA, EggNOG
Horse100065303PAX8paired box 89796VGNC:21178Inparanoid, OMA, EggNOG
Cow534661PAX8paired box 89913VGNC:32599Inparanoid, OMA, EggNOG
Opossum100026381PAX8paired box 813616Inparanoid, EggNOG
PlatypusPAX8paired box 8 [Source:HGNC Symbol;Acc:HGNC:8622]9258OMA, EggNOG
Xenopus780226pax8paired box 88364XB-GENE-483693Inparanoid, OMA
Zebrafish60637pax8paired box 87955ZDB-GENE-001030-3Inparanoid, OMA

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.