Il negozio non funziona correttamente quando i cookie sono disabilitati.
I JavaScript sembrano essere disabilitati nel tuo browser. Per una migliore esperienza sul nostro sito, assicurati di attivare i javascript nel tuo browser.
224,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino
DAZAP1 Descrizione DAZ-associated protein 1
Gene and Protein Information Gene ID 26528 Uniprot Accession IDs Q96EP5 Q96MJ3 Q9NRR9 Ensembl ID ENSP00000233078 Sequence MNNSGADEIGKLFVGGLDWSTTQETLRSYFSQYGEVVDCVIMKDKTTNQSRGFGFVKFKDPNCVGTVLASRPHTLDGRNIDPKPCTPRGMQPERTRPKEGWQKGPRSDNSKSNKIFVGGIPHNCGETELREYFKKFGVVTEVVMIYDAEKQRPRGFGFITFEDEQSVDQAVNMHFHDIMGKKVEVKRAEPRDSKSQAPGQPGASQWGSRVVPNAANGWAGQPPPTWQQGYGPQGMWVPAGQAIGGYGPPPAGRGAPPPPPPFTSYIVSTPPGGFPPPQGFPQGYGAPPQFSFGYGPPPPPPDQFAPPGVPPPPATPGAAPLAFPPPPSQAAPDMSKPPTAQPDFPYGQYAGYGQDLSGFGQGFSDPSQQPPSYGGPSVPGSGGPPAGGSGFGRGQNHNVQGFHPYRR
Mostra altro
Homologous gene and protein info.
Species Gene ID Gene Symbol Nome Codice fiscale Other Gene ID Sorgenti Chimp 455549 DAZAP1 DAZ associated protein 1 9598 VGNC:10983 OMA, EggNOG Macaque 707132 DAZAP1 DAZ associated protein 1 9544 Inparanoid, OMA, EggNOG Mouse 70248 Dazap1 DAZ associated protein 1 10090 MGI:1917498 Inparanoid, OMA, EggNOG Rat 362836 Dazap1 DAZ associated protein 1 10116 RGD:1305280 Inparanoid, OMA, EggNOG Dog 100683271 DAZAP1 DAZ associated protein 1 9615 VGNC:39778 Inparanoid, OMA, EggNOG Horse DAZAP1 DAZ associated protein 1 [Source:HGNC Symbol;Acc:HGNC:2683] 9796 OMA, EggNOG Cow 614783 DAZAP1 DAZ associated protein 1 9913 VGNC:27885 Inparanoid, OMA, EggNOG Pig 100625005 DAZAP1 DAZ associated protein 1 9823 Inparanoid, OMA, EggNOG Opossum 100020847 DAZAP1 DAZ associated protein 1 13616 Inparanoid, OMA, EggNOG Platypus 100076674 DAZAP1 DAZ associated protein 1 9258 Inparanoid, OMA, EggNOG Chicken 427266 DAZAP1 DAZ associated protein 1 9031 CGNC:11311 Inparanoid, OMA, EggNOG Xenopus 448406 dazap1 DAZ associated protein 1 8364 XB-GENE-856469 Inparanoid, OMA, EggNOG Zebrafish 561459 dazap1 DAZ associated protein 1 7955 ZDB-GENE-070212-1 Inparanoid, OMA Fruitfly 33968 Hrb27C Heterogeneous nuclear ribonucleoprotein at 27C 7227 FBgn0004838 Inparanoid, EggNOG
Associated Recombinant Proteins Nome Specification and purity Expression system Protein label Disponibilità Vedi dettagli
Associated Antibodies
Nome Specifications Species reactivity Applicazione Disponibilità Vedi dettagli
Associated Approved Drugs Associated Active Ligands Associated Diseases Nome Direct Associated Targets Disease Type Mondoid
We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our
Cookie Policy. Impostazioni Accetto tutto Decline
Shall we send you a message when we have discounts available?
Remind me later Permetti
Thank you! Please check your email inbox to confirm.
Oops! Notifications are disabled.
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.