🌎 Ship to: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS / CoA Structure Massivo e personalizzato
Menu
Account
Impostazioni
྾
224,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

PSME1

DescrizioneProteasome activator complex subunit 1

Gene and Protein Information

Gene ID5720
Uniprot Accession IDs Q06323 A6NJG9 H0YNE3 Q6IBM2 Q9UEF4
Ensembl ID ENSP00000372155
Symbol IFI5111 PA28A IFI5111 REGalpha PA28alpha HEL-S-129m
FamilyBelongs to the PA28 family.
Sequence
MAMLRVQPEAQAKVDVFREDLCTKTENLLGSYFPKKISELDAFLKEPALNEANLSNLKAPLDIPVPDPVKEKEKEERKKQQEKEDKDEKKKGEDEDKGPPCGPVNCNEKIVVLLQRLKPEIKDVIEQLNLVTTWLQLQIPRIEDGNNFGVAVQEKVFELMTSLHTKLEGFHTQISKYFSERGDAVTKAAKQPHVGDYRQLVHELDEAEYRDIRLMVMEIRNAYAVLYDIILKNFEKLKKPRGETKGMIY
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp452809PSME1proteasome activator subunit 19598VGNC:3334OMA, EggNOG
Macaque714364PSME1proteasome activator subunit 19544Inparanoid, OMA, EggNOG
Mouse19186Psme1proteasome (prosome, macropain) activator subunit 1 (PA28 alpha)10090MGI:1096367Inparanoid, OMA, EggNOG
Rat29630Psme1proteasome activator subunit 110116RGD:3429Inparanoid, OMA, EggNOG
Dog480256PSME1proteasome activator subunit 19615VGNC:45116Inparanoid, OMA, EggNOG
Cow510041PSME1proteasome activator subunit 19913VGNC:33473Inparanoid, OMA, EggNOG
Pig397572PSME1proteasome activator subunit 19823Inparanoid, OMA, EggNOG
Opossum100025042PSME1proteasome activator subunit 113616Inparanoid, EggNOG
Anole lizard100557206LOC100557206proteasome activator complex subunit 128377OMA, EggNOG
Xenopus496755psme1proteasome activator subunit 18364XB-GENE-974277Inparanoid, OMA, EggNOG
Zebrafish30648psme1proteasome activator subunit 17955ZDB-GENE-991110-17Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.