🌎 Ship to: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS / CoA Structure Massivo e personalizzato
Menu
Account
Impostazioni
྾
224,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

PSMF1

DescrizioneProteasome inhibitor PI31 subunit

Gene and Protein Information

Gene ID9491
Uniprot Accession IDs Q92530 A0AVQ9 D3DVW3 Q9H4I1 hPI31
Ensembl ID ENSP00000338039
Symbol PI31
FamilyBelongs to the proteasome inhibitor PI31 family.
Sequence
MAGLEVLFASAAPAITCRQDALVCFLHWEVVTHGYFGLGVGDQPGPNDKKSELLPAGWNNNKDLYVLRYEYKDGSRKLLVKAITVESSMILNVLEYGSQQVADLTLNLDDYIDAEHLGDFHRTYKNSEELRSRIVSGIITPIHEQWEKANVSSPHREFPPATAREVDPLRIPPHHPHTSRQPPWCDPLGPFVVGGEDLDPFGPRRGGMIVDPLRSGFPRALIDPSSGLPNRLPPGAVPPGARFDPFGPIGTSPPGPNPDHLPPPGYDDMYL
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp458030PSMF1proteasome inhibitor subunit 19598VGNC:6252OMA, EggNOG
Macaque715314PSMF1proteasome inhibitor subunit 19544Inparanoid, OMA, EggNOG
Mouse228769Psmf1proteasome (prosome, macropain) inhibitor subunit 110090MGI:1346072Inparanoid, OMA, EggNOG
Rat689852Psmf1proteasome inhibitor subunit 110116RGD:1587528Inparanoid, OMA, EggNOG
Dog477184PSMF1proteasome inhibitor subunit 19615VGNC:45120Inparanoid, OMA, EggNOG
Horse100053261PSMF1proteasome inhibitor subunit 19796VGNC:21968Inparanoid, OMA, EggNOG
Cow617807PSMF1proteasome inhibitor subunit 19913VGNC:33477Inparanoid, OMA, EggNOG
Opossum100011595PSMF1proteasome inhibitor subunit 113616Inparanoid, EggNOG
Chicken430115PSMF1proteasome inhibitor subunit 19031CGNC:152Inparanoid, OMA, EggNOG
Anole lizard100564274psmf1proteasome inhibitor subunit 128377Inparanoid, OMA, EggNOG
Zebrafish436820psmf1proteasome inhibitor subunit 17955ZDB-GENE-040718-282Inparanoid, OMA
Fruitfly36277PI31Proteasome inhibitor 31 kDa7227FBgn0033669Inparanoid, EggNOG

Protein Classes

PANTHER Classes
protein    /    enzyme modulator    /    protease inhibitor    /    Proteasome inhibitor PI31 subunit
DTO Classes
protein    /    Enzyme modulator    /    Protease inhibitor    /    Proteasome inhibitor PI31 subunit

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.