🌎 Ship to: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS / CoA Structure Massivo e personalizzato
Menu
Account
Impostazioni
྾
224,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

MYL1

DescrizioneMyosin light chain 1/3, skeletal muscle isoform

Gene and Protein Information

Gene ID4632
Uniprot Accession IDs P05976 B2R4N6 B2R4T6 P06741 Q6IBD5 MLC1/MLC3
Ensembl ID ENSP00000307280
Symbol MLC1F MLC3F
Sequence
MAPKKDVKKPVAAAAAAPAPAPAPAPAPAPAKPKEEKIDLSAIKIEFSKEQQDEFKEAFLLFDRTGDSKITLSQVGDVLRALGTNPTNAEVRKVLGNPSNEELNAKKIEFEQFLPMMQAISNNKDQATYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMKEEEVEALMAGQEDSNGCINYEAFVKHIMSI
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp459915MYL1myosin light chain 19598VGNC:2050OMA, EggNOG
Mouse17901Myl1myosin, light polypeptide 110090MGI:97269Inparanoid, OMA, EggNOG
Rat56781Myl1myosin, light chain 110116RGD:1598796Inparanoid, OMA, EggNOG
Dog478896MYL1myosin light chain 19615VGNC:43541Inparanoid, OMA, EggNOG
Horse100052501MYL1myosin light chain 19796VGNC:20482OMA, EggNOG
Cow317657MYL1myosin light chain 19913VGNC:31799Inparanoid, OMA, EggNOG
Pig397666MYL1myosin light chain 19823Inparanoid, OMA, EggNOG
Opossum100013093MYL1myosin light chain 113616Inparanoid, OMA, EggNOG
Platypus100077064MYL1myosin light chain 19258Inparanoid, OMA, EggNOG
Chicken396470MYL1myosin, light chain 1, alkali; skeletal, fast9031CGNC:49821OMA, EggNOG
Anole lizard100558249myl1myosin light chain 128377Inparanoid, OMA, EggNOG
Xenopus394551myl1myosin light chain 18364XB-GENE-970333Inparanoid, OMA, EggNOG
Zebrafish336165myl1myosin, light chain 1, alkali; skeletal, fast7955ZDB-GENE-030131-8109Inparanoid, EggNOG
C. elegans175768mlc-3Myosin Light Chain6239OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    calcium-binding protein    /    calmodulin    /    Myosin light chain 1/3, skeletal muscle isoform
protein    /    calcium-binding protein    /    actin family cytoskeletal protein    /    Myosin light chain 1/3, skeletal muscle isoform
DTO Classes
protein    /    Calcium-binding protein    /    Intracellular calcium-sensing protein    /    Calmodulin    /    Myosin light chain 1/3, skeletal muscle isoform

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.