NMBR

DescrizioneNeuromedin-B receptor

Gene and Protein Information

Gene ID4829
Uniprot Accession IDs P28336 E9KL38 Q5VUK8 NMB-R
Ensembl ID ENSP00000258042
Symbol BB1 BB1R NMB-R
FamilyBelongs to the G-protein coupled receptor 1 family.
Sequence
MPSKSLSNLSVTTGANESGSVPEGWERDFLPASDGTTTELVIRCVIPSLYLLIITVGLLGNIMLVKIFITNSAMRSVPNIFISNLAAGDLLLLLTCVPVDASRYFFDEWMFGKVGCKLIPVIQLTSVGVSVFTLTALSADRYRAIVNPMDMQTSGALLRTCVKAMGIWVVSVLLAVPEAVFSEVARISSLDNSSFTACIPYPQTDELHPKIHSVLIFLVYFLIPLAIISIYYYHIAKTLIKSAHNLPGEYNEHTKKQMETRKRLAKIVLVFVGCFIFCWFPNHILYMYRSFNYNEIDPSLGHMIVTLVARVLSFGNSCVNPFALYLLSESFRRHFNSQLCCGRKSYQERGTSYLLSSSAVRMTSLKSNAKNMVTNSVLLNGHSMKQEMAL
Mostra altro
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp472141NMBRneuromedin B receptor9598VGNC:3592OMA, EggNOG
Mouse18101Nmbrneuromedin B receptor10090MGI:1100525Inparanoid, OMA, EggNOG
Dog611644NMBRneuromedin B receptor9615VGNC:43855Inparanoid, OMA, EggNOG
Horse100060776NMBRneuromedin B receptor9796VGNC:20773Inparanoid, OMA, EggNOG
Cow539776NMBRneuromedin B receptor9913VGNC:32124Inparanoid, OMA, EggNOG
Opossum100031729NMBRneuromedin B receptor13616Inparanoid, OMA, EggNOG
PlatypusNMBRneuromedin B receptor [Source:HGNC Symbol;Acc:HGNC:7843]9258OMA, EggNOG
Chicken428610NMBRneuromedin B receptor9031CGNC:10338Inparanoid, OMA, EggNOG
Anole lizard100560895nmbrneuromedin B receptor28377Inparanoid, OMA, EggNOG
Xenopusnmbrneuromedin B receptor [Source:Xenbase;Acc:XB-GENE-6074611]8364OMA, EggNOG
Zebrafish561834nmbrneuromedin B receptor7955ZDB-GENE-041014-369Inparanoid, OMA, EggNOG

Protein Classes

DTO Classes
protein    /    G-protein coupled receptor    /    Class A rhodopsin like    /    Bombesin receptor    /    Neuromedin-B receptor

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.