🌎 Ship to: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS CoA Structure
Menu
Account
Impostazioni
྾
224,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

SLC10A1

DescrizioneSodium/bile acid cotransporter

Gene and Protein Information

Gene ID6554
Uniprot Accession IDs Q14973 B9EGB6 Q2TU29
Ensembl ID ENSP00000216540
Symbol NTCP NTCP
FamilyBelongs to the bile acid:sodium symporter (BASS) (TC 2.A.28) family.
Sequence
MEAHNASAPFNFTLPPNFGKRPTDLALSVILVFMLFFIMLSLGCTMEFSKIKAHLWKPKGLAIALVAQYGIMPLTAFVLGKVFRLKNIEALAILVCGCSPGGNLSNVFSLAMKGDMNLSIVMTTCSTFCALGMMPLLLYIYSRGIYDGDLKDKVPYKGIVISLVLVLIPCTIGIVLKSKRPQYMRYVIKGGMIIILLCSVAVTVLSAINVGKSIMFAMTPLLIATSSLMPFIGFLLGYVLSALFCLNGRCRRTVSMETGCQNVQLCSTILNVAFPPEVIGPLFFFPLLYMIFQLGEGLLLIAIFWCYEKFKTPKDKTKMIYTAATTEETIPGALGNGTYKGEDCSPCTA
Mostra altro
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp453001SLC10A1solute carrier family 10 member 19598VGNC:8206OMA, EggNOG
Macaque712925SLC10A1solute carrier family 10 member 19544Inparanoid, OMA, EggNOG
Mouse20493Slc10a1solute carrier family 10 (sodium/bile acid cotransporter family), member 110090MGI:97379Inparanoid, OMA, EggNOG
Rat24777Slc10a1solute carrier family 10 member 110116RGD:3681Inparanoid, OMA, EggNOG
Dog480372SLC10A1solute carrier family 10 member 19615VGNC:46211Inparanoid, OMA, EggNOG
Horse100064290SLC10A1solute carrier family 10 member 19796VGNC:23011Inparanoid, OMA, EggNOG
Cow532890SLC10A1solute carrier family 10 member 19913VGNC:34659Inparanoid, OMA, EggNOG
Pig100153302SLC10A1solute carrier family 10 member 19823OMA, EggNOG
Opossum100028851SLC10A1solute carrier family 10 member 113616Inparanoid, EggNOG
Anole lizardSLC10A1solute carrier family 10 member 1 [Source:HGNC Symbol;Acc:HGNC:10905]28377Inparanoid, OMA, EggNOG
XenopusSLC10A1solute carrier family 10 member 1 [Source:HGNC Symbol;Acc:HGNC:10905]8364OMA, EggNOG
Zebrafish562260slc10a1solute carrier family 10 (sodium/bile acid cotransporter), member 17955ZDB-GENE-041001-190Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    transporter    /    cation transporter    /    Sodium/bile acid cotransporter
DTO Classes
protein    /    Transporter    /    SLC superfamily of solute carriers    /    SLC10 family of sodium-bile acid co-transporters    /    Sodium/bile acid cotransporter

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.