🌎 Ship to: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS CoA Structure
Menu
Account
Impostazioni
྾
224,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

OSM

DescrizioneOncostatin-M

Gene and Protein Information

Gene ID5008
Uniprot Accession IDs P13725 Q6FHP8 Q9UCP6 OSM
Ensembl ID ENSP00000215781
FamilyBelongs to the LIF/OSM family.
Sequence
MGVLLTQRTLLSLVLALLFPSMASMAAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRRHSPHQALRKGVRRTRPSRKGKRLMTRGQLPR
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp736338OSMoncostatin M9598VGNC:6023OMA, EggNOG
Macaque717994OSMoncostatin M9544Inparanoid, OMA, EggNOG
Mouse18413Osmoncostatin M10090MGI:104749Inparanoid, OMA, EggNOG
Rat289747Osmoncostatin M10116RGD:1585012Inparanoid, OMA, EggNOG
Dog611921OSMoncostatin M9615VGNC:44166Inparanoid, OMA, EggNOG
Horse100064031OSMoncostatin M9796VGNC:21074Inparanoid, OMA, EggNOG
Cow319086OSMoncostatin M9913VGNC:32474Inparanoid, OMA, EggNOG
Pig100152038OSMoncostatin M9823OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    signaling molecule    /    interleukin superfamily    /    Oncostatin-M
DTO Classes
protein    /    Signaling    /    Cytokine    /    Interleukin superfamily    /    Oncostatin-M

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.