🌎 Ship to: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS / CoA Structure Massivo e personalizzato
Menu
Account
Impostazioni
྾
224,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

NIP7

Descrizione60S ribosome subunit biogenesis protein NIP7 homolog

Gene and Protein Information

Gene ID51388
Uniprot Accession IDs Q9Y221 B2RD04 Q9NZZ0
Ensembl ID ENSP00000254940
Symbol KD93 CGI-37 HSPC031
FamilyBelongs to the NIP7 family.
Sequence
MRPLTEEETRVMFEKIAKYIGENLQLLVDRPDGTYCFRLHNDRVYYVSEKIMKLAANISGDKLVSLGTCFGKFTKTHKFRLHVTALDYLAPYAKYKVWIKPGAEQSFLYGNHVLKSGLGRITENTSQYQGVVVYSMADIPLGFGVAAKSTQDCRKVDPMAIVVFHQADIGEYVRHEETLT
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp454200NIP7NIP7, nucleolar pre-rRNA processing protein9598VGNC:13745Inparanoid, OMA
Mouse66164Nip7NIP7, nucleolar pre-rRNA processing protein10090MGI:1913414Inparanoid, OMA, EggNOG
Rat192180Nip7NIP7, nucleolar pre-rRNA processing protein10116RGD:620069Inparanoid, OMA, EggNOG
Dog479673NIP7NIP7, nucleolar pre-rRNA processing protein9615VGNC:43814Inparanoid, OMA, EggNOG
Horse100630672NIP7NIP7, nucleolar pre-rRNA processing protein9796VGNC:51267Inparanoid, EggNOG
Cow509981NIP7NIP7, nucleolar pre-rRNA processing protein9913VGNC:32080Inparanoid, OMA, EggNOG
Opossum100028016NIP7NIP7, nucleolar pre-rRNA processing protein13616Inparanoid, EggNOG
Chicken415863NIP7NIP7, nucleolar pre-rRNA processing protein9031CGNC:410Inparanoid, OMA, EggNOG
Anole lizard100559757nip7NIP7, nucleolar pre-rRNA processing protein28377Inparanoid, OMA, EggNOG
Xenopus100125143nip7NIP7, nucleolar pre-rRNA processing protein8364XB-GENE-1005412Inparanoid, OMA, EggNOG
Zebrafish553616nip7NIP7, nucleolar pre-rRNA processing protein7955ZDB-GENE-050522-256Inparanoid, OMA, EggNOG
C. elegans172028C43E11.960S ribosome subunit biogenesis protein NIP7 homolog6239Inparanoid, OMA
Fruitfly42963CG7006CG7006 gene product from transcript CG7006-RA7227FBgn0039233Inparanoid, EggNOG
S.cerevisiae855890NIP7ribosome biosynthesis protein NIP74932S000006132Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.