NOX1

DescrizioneNADPH oxidase 1

Gene and Protein Information

Gene ID27035
Uniprot Accession IDs Q9Y5S8 A8K836 O95691 Q2PP02 NOX-1
Ensembl ID ENSP00000362057
Symbol MOX1 NOH1 MOX1 NOH1 NOH-1 GP91-2
Sequence
MGNWVVNHWFSVLFLVVWLGLNVFLFVDAFLKYEKADKYYYTRKILGSTLACARASALCLNFNSTLILLPVCRNLLSFLRGTCSFCSRTLRKQLDHNLTFHKLVAYMICLHTAIHIIAHLFNFDCYSRSRQATDGSLASILSSLSHDEKKGGSWLNPIQSRNTTVEYVTFTSIAGLTGVIMTIALILMVTSATEFIRRSYFEVFWYTHHLFIFYILGLGIHGIGGIVRGQTEESMNESHPRKCAESFEMWDDRDSHCRRPKFEGHPPESWKWILAPVILYICERILRFYRSQQKVVITKVVMHPSKVLELQMNKRGFSMEVGQYIFVNCPSISLLEWHPFTLTSAPEEDFFSIHIRAAGDWTENLIRAFEQQYSPIPRIEVDGPFGTASEDVFQYEVAVLVGAGIGVTPFASILKSIWYKFQCADHNLKTKKIYFYWICRETGAFSWFNNLLTSLEQEMEELGKVGFLNYRLFLTGWDSNIVGHAALNFDKATDIVTGLKQKTSFGRPMWDNEFSTIATSHPKSVVGVFLCGPRTLAKSLRKCCHRYSSLDPRKVQFYFNKENF
Mostra altro
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Macaque701376NOX1NADPH oxidase 19544Inparanoid, OMA, EggNOG
Mouse237038Nox1NADPH oxidase 110090MGI:2450016Inparanoid, OMA, EggNOG
Rat114243Nox1NADPH oxidase 110116RGD:620598Inparanoid, OMA, EggNOG
Dog492016NOX1NADPH oxidase 19615VGNC:43903Inparanoid, OMA, EggNOG
Horse100146916NOX1NADPH oxidase 19796VGNC:20822Inparanoid, OMA, EggNOG
Cow521681NOX1NADPH oxidase 19913VGNC:32182Inparanoid, OMA, EggNOG
Pig100739822NOX1NADPH oxidase 19823OMA, EggNOG

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.