🌎 Ship to: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS / CoA Structure Massivo e personalizzato
Menu
Account
Impostazioni
྾
224,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

HSPE1

Descrizione10 kDa heat shock protein, mitochondrial

Gene and Protein Information

Gene ID3336
Uniprot Accession IDs P61604 O95421 Q04984 Q53X54 Q9UDH0 Hsp10
Ensembl ID ENSP00000233893
Symbol EPF CPN10 GROES HSP10
FamilyBelongs to the GroES chaperonin family.
Sequence
MAGQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVVAVGSGSKGKGGEIQPVSVKVGDKVLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp459853HSPE1heat shock protein family E (Hsp10) member 19598VGNC:10839OMA, EggNOG
Mouse15528Hspe1heat shock protein 1 (chaperonin 10)10090MGI:104680Inparanoid, OMA, EggNOG
Rat25462Hspe1heat shock protein family E member 110116RGD:2844Inparanoid, OMA
Horse100070523LOC10007052310 kDa heat shock protein, mitochondrial9796OMA, EggNOG
Cow281833HSPE1heat shock protein family E (Hsp10) member 19913VGNC:49071Inparanoid, OMA, EggNOG
Pig397575HSPE1heat shock protein family E (Hsp10) member 19823Inparanoid, OMA, EggNOG
Chicken395948HSPE1heat shock protein family E (Hsp10) member 19031CGNC:49569Inparanoid, OMA
Anole lizardHSPE1heat shock protein family E (Hsp10) member 1 [Source:HGNC Symbol;Acc:HGNC:5269]28377Inparanoid, OMA, EggNOG
Xenopus448701hspe1heat shock protein family E (Hsp10) member 18364XB-GENE-963412Inparanoid, OMA, EggNOG
Zebrafish58041hspe1heat shock 10 protein 17955ZDB-GENE-000906-2Inparanoid, OMA, EggNOG
C. elegans175315Y22D7AL.10hypothetical protein6239OMA, EggNOG
S.cerevisiae854185HSP10Hsp10p4932S000005546Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    chaperone    /    chaperonin    /    10 kDa heat shock protein, mitochondrial
DTO Classes
protein    /    Chaperone    /    Chaperonin    /    10 kDa heat shock protein, mitochondrial

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.