🌎 Ship to: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS / CoA Structure Massivo e personalizzato
Menu
Account
Impostazioni
྾
224,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

IL21R

DescrizioneInterleukin-21 receptor

Gene and Protein Information

Gene ID50615
Uniprot Accession IDs Q9HBE5 A8K9E8 D3DWF7 Q96HZ1 Q9HB91 IL-21 receptor
Ensembl ID ENSP00000338010
Symbol NILR NILR CD360 IMD56
FamilyBelongs to the type I cytokine receptor family. Type 4 subfamily.
Sequence
MPRGWAAPLLLLLLQGGWGCPDLVCYTDYLQTVICILEMWNLHPSTLTLTWQDQYEELKDEATSCSLHRSAHNATHATYTCHMDVFHFMADDIFSVNITDQSGNYSQECGSFLLAESIKPAPPFNVTVTFSGQYNISWRSDYEDPAFYMLKGKLQYELQYRNRGDPWAVSPRRKLISVDSRSVSLLPLEFRKDSSYELQVRAGPMPGSSYQGTWSEWSDPVIFQTQSEELKEGWNPHLLLLLLLVIVFIPAFWSLKTHPLWRLWKKIWAVPSPERFFMPLYKGCSGDFKKWVGAPFTGSSLELGPWSPEVPSTLEVYSCHPPRSPAKRLQLTELQEPAELVESDGVPKPSFWPTAQNSGGSAYSEERDRPYGLVSIDTVTVLDAEGPCTWPCSCEDDGYPALDLDAGLEPSPGLEDPLLDAGTTVLSCGCVSAGSPGLGGPLGSLLDRLKPPLADGEDWAGGLPWGGRSPGGVSESEAGSPLAGLDMDTFDSGFVGSDCSSPVECDFTSPGDEGPPRSYLRQWVVIPPPLSSPGPQAS
Mostra altro
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Macaque705759IL21Rinterleukin 21 receptor9544Inparanoid, OMA, EggNOG
Mouse60504Il21rinterleukin 21 receptor10090MGI:1890475Inparanoid, OMA, EggNOG
Rat308977Il21rinterleukin 21 receptor10116RGD:1304950Inparanoid, OMA, EggNOG
Dog608011IL21Rinterleukin 21 receptor9615VGNC:41968Inparanoid, OMA, EggNOG
Horse100066814IL21Rinterleukin 21 receptor9796VGNC:19017Inparanoid, OMA, EggNOG
Cow617967IL21Rinterleukin 21 receptor9913VGNC:30142Inparanoid, OMA, EggNOG
Pig100518723IL21Rinterleukin 21 receptor9823OMA, EggNOG
Opossum100016040IL21Rinterleukin 21 receptor13616Inparanoid, OMA, EggNOG
Chicken416586IL21Rinterleukin 21 receptor9031CGNC:4749Inparanoid, OMA, EggNOG
Anole lizard103281084il21rinterleukin 21 receptor28377Inparanoid, OMA
Xenopus100492452il21rinterleukin 21 receptor8364XB-GENE-490256Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    receptor    /    type I cytokine receptor    /    Interleukin-21 receptor
DTO Classes
protein    /    Receptor    /    Cytokine receptor    /    Type I cytokine receptor    /    Interleukin-21 receptor

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.