🌎 Ship to: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS / CoA Structure Massivo e personalizzato
Menu
Account
Impostazioni
྾
224,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

MAPK1

DescrizioneMitogen-activated protein kinase 1

Gene and Protein Information

Gene ID5594
Uniprot Accession IDs P28482 A8CZ64 MAP kinase 1
Ensembl ID ENSP00000215832
Symbol ERK2 PRKM1 PRKM2 ERK p38 p40 p41 ERK2 ERT1 ERK-2 MAPK2 PRKM1 PRKM2 P42MAPK p41mapk p42-MAPK
FamilyBelongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. MAP kinase subfamily.
Sequence
MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
Mostra altro
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp458680MAPK1mitogen-activated protein kinase 19598VGNC:12896OMA, EggNOG
Macaque698569MAPK1mitogen-activated protein kinase 19544Inparanoid, OMA, EggNOG
Mouse26413Mapk1mitogen-activated protein kinase 110090MGI:1346858Inparanoid, OMA
Rat116590Mapk1mitogen activated protein kinase 110116RGD:70500Inparanoid, OMA, EggNOG
Dog477575MAPK1mitogen-activated protein kinase 19615VGNC:42991Inparanoid, OMA, EggNOG
Horse100057701MAPK1mitogen-activated protein kinase 19796VGNC:19954Inparanoid, OMA, EggNOG
Cow327672MAPK1mitogen-activated protein kinase 19913VGNC:31212Inparanoid, OMA, EggNOG
Pig100153927MAPK1mitogen-activated protein kinase 19823Inparanoid, OMA, EggNOG
Opossum100028096MAPK1mitogen-activated protein kinase 113616OMA, EggNOG
Chicken373953MAPK1mitogen-activated protein kinase 19031CGNC:48975Inparanoid, OMA
Anole lizard100555877mapk1mitogen-activated protein kinase 128377Inparanoid, OMA
Xenopus549881mapk1mitogen-activated protein kinase 18364XB-GENE-479467Inparanoid, OMA
Zebrafish360144mapk1mitogen-activated protein kinase 17955ZDB-GENE-030722-2Inparanoid, OMA

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.