🌎 Ship to: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS / CoA Structure Massivo e personalizzato
Menu
Account
Impostazioni
྾
224,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

LANCL2

DescrizioneLanC-like protein 2

Gene and Protein Information

Gene ID55915
Uniprot Accession IDs Q9NS86 B2R8D4 Q6NSL4 Q8TCQ3 Q9BSR1
Ensembl ID ENSP00000254770
Symbol GPR69B TASP TASP GPR69B
FamilyBelongs to the LanC-like protein family.
Sequence
MGETMSKRLKLHLGGEAEMEERAFVNPFPDYEAAAGALLASGAAEETGCVRPPATTDEPGLPFHQDGKIIHNFIRRIQTKIKDLLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRVTCDQTYLLRSLDYVKRTLRNLNGRRVTFLCGDAGPLAVGAVIYHKLRSDCESQECVTKLLQLQRSVVCQESDLPDELLYGRAGYLYALLYLNTEIGPGTVCESAIKEVVNAIIESGKTLSREERKTERCPLLYQWHRKQYVGAAHGMAGIYYMLMQPAAKVDQETLTEMVKPSIDYVRHKKFRSGNYPSSLSNETDRLVHWCHGAPGVIHMLMQAYKVFKEEKYLKEAMECSDVIWQRGLLRKGYGICHGTAGNGYSFLSLYRLTQDKKYLYRACKFAEWCLDYGAHGCRIPDRPYSLFEGMAGAIHFLSDVLGPETSRFPAFELDSSKRD
Mostra altro
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp463936LANCL2LanC like 29598VGNC:7399OMA, EggNOG
Macaque704882LANCL2LanC like 29544Inparanoid, OMA, EggNOG
Mouse71835Lancl2LanC (bacterial lantibiotic synthetase component C)-like 210090MGI:1919085Inparanoid, OMA, EggNOG
Rat362375Lancl2LanC like 210116RGD:1310809Inparanoid, OMA, EggNOG
Dog483240LANCL2LanC like 29615VGNC:49916Inparanoid, OMA, EggNOG
Horse100067823LANCL2LanC like 29796VGNC:19579Inparanoid, OMA, EggNOG
Cow541142LANCL2LanC like 29913VGNC:30784Inparanoid, OMA, EggNOG
Pig100620078LANCL2LanC like 29823OMA, EggNOG
Opossum100029611LANCL2LanC like 213616Inparanoid, OMA, EggNOG
PlatypusLANCL2LanC like 2 [Source:HGNC Symbol;Acc:HGNC:6509]9258OMA, EggNOG
Anole lizard100562031lancl2LanC like 228377Inparanoid, OMA
Xenopus734145lancl2LanC like 28364XB-GENE-5744525Inparanoid, OMA

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.