🌎 Ship to: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS / CoA Structure Massivo e personalizzato
Menu
Account
Impostazioni
྾
224,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

MYL2

DescrizioneMyosin regulatory light chain 2, ventricular/cardiac muscle isoform

Gene and Protein Information

Gene ID4633
Uniprot Accession IDs P10916 Q16123 MLC-2
Ensembl ID ENSP00000228841
Symbol MLC2 MLC2 CMH10 MLC-2s/v
Sequence
MAPKKAKKRAGGANSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVNVKNEEIDEMIKEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGVLKADYVREMLTTQAERFSKEEVDQMFAAFPPDVTGNLDYKNLVHIITHGEEKD
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Macaque711937MYL2myosin light chain 29544Inparanoid, OMA, EggNOG
Mouse17906Myl2myosin, light polypeptide 2, regulatory, cardiac, slow10090MGI:97272Inparanoid, OMA, EggNOG
Rat363925Myl2myosin light chain 210116RGD:1564245Inparanoid, OMA
Dog403614MYL2myosin light chain 29615VGNC:43543Inparanoid, OMA, EggNOG
Horse100147688MYL2myosin light chain 29796VGNC:20483Inparanoid, OMA, EggNOG
Cow505519MYL2myosin light chain 29913VGNC:31800Inparanoid, OMA, EggNOG
Opossum100019715MYL2myosin light chain 213616Inparanoid, OMA, EggNOG
Platypus100074559MYL2myosin light chain 29258OMA, EggNOG
Chicken416874MYL2myosin, light chain 2, regulatory, cardiac, slow9031CGNC:50364Inparanoid, OMA
Anole lizard100566191myl2myosin light chain 228377Inparanoid, OMA
Xenopus100135705myl2myosin light chain 28364XB-GENE-482091Inparanoid, OMA
Zebrafish677750myl2bmyosin, light chain 2b, regulatory, cardiac, slow7955ZDB-GENE-060331-137Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    calcium-binding protein    /    calmodulin    /    Myosin regulatory light chain 2, ventricular/cardiac muscle isoform
protein    /    calcium-binding protein    /    actin family cytoskeletal protein    /    Myosin regulatory light chain 2, ventricular/cardiac muscle isoform
DTO Classes
protein    /    Calcium-binding protein    /    Intracellular calcium-sensing protein    /    Calmodulin    /    Myosin regulatory light chain 2, ventricular/cardiac muscle isoform

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.