CDC25C

DescrizioneM-phase inducer phosphatase 3

Gene and Protein Information

Gene ID995
Uniprot Accession IDs P30307 D3DQB8 Q96PL3 Q9H168 Q9H2E8 Q9H2E9 Q9H2F1
Ensembl ID ENSP00000321656
Symbol CDC25 PPP1R60
FamilyBelongs to the MPI phosphatase family.
Sequence
MSTELFSSTREEGSSGSGPSFRSNQRKMLNLLLERDTSFTVCPDVPRTPVGKFLGDSANLSILSGGTPKRCLDLSNLSSGEITATQLTTSADLDETGHLDSSGLQEVHLAGMNHDQHLMKCSPAQLLCSTPNGLDRGHRKRDAMCSSSANKENDNGNLVDSEMKYLGSPITTVPKLDKNPNLGEDQAEEISDELMEFSLKDQEAKVSRSGLYRSPSMPENLNRPRLKQVEKFKDNTIPDKVKKKYFSGQGKLRKGLCLKKTVSLCDITITQMLEEDSNQGHLIGDFSKVCALPTVSGKHQDLKYVNPETVAALLSGKFQGLIEKFYVIDCRYPYEYLGGHIQGALNLYSQEELFNFFLKKPIVPLDTQKRIIIVFHCEFSSERGPRMCRCLREEDRSLNQYPALYYPELYILKGGYRDFFPEYMELCEPQSYCPMHHQDHKTELLRCRSQSKVQEGERQLREQIALLVKDMSP
Mostra altro
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp746151CDC25Ccell division cycle 25C9598VGNC:3940OMA, EggNOG
Macaque714115CDC25Ccell division cycle 25C9544Inparanoid, OMA, EggNOG
Mouse12532Cdc25ccell division cycle 25C10090MGI:88350Inparanoid, OMA, EggNOG
Rat307511Cdc25ccell division cycle 25C10116RGD:1311875Inparanoid, OMA
Dog610456CDC25Ccell division cycle 25C9615VGNC:38991Inparanoid, OMA, EggNOG
Horse100062352CDC25Ccell division cycle 25C9796VGNC:16292Inparanoid, OMA, EggNOG
Cow507731CDC25Ccell division cycle 25C9913VGNC:27064Inparanoid, OMA, EggNOG
Pig100144474CDC25Ccell division cycle 25C9823Inparanoid, OMA, EggNOG
Opossum100025023CDC25Ccell division cycle 25C13616Inparanoid, EggNOG
Anole lizard100565034cdc25ccell division cycle 25C28377Inparanoid, OMA, EggNOG
Xenopus100124300cdc25ccell division cycle 25C8364XB-GENE-944821Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.