Toggle Nav 
Cerca
340,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino
| Descrizione | NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial |
|---|
Gene and Protein Information
| Gene ID | 4708 |
|---|---|
| Uniprot Accession IDs | O95178 Q6FGI6 |
| Ensembl ID | ENSP00000419087 |
| Symbol | AGGG CI-AGGG |
| Family | Belongs to the complex I NDUFB2 subunit family. |
| Sequence | MSALTRLASFARVGGRLFRSGCARTAGDGGVRHAGGGVHIEPRYRQFPQLTRSQVFQSEFFSGLMWFWILWRFWHDSEEVLGHFPYPDPSQWTDEELGIPPDDED |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nome | Codice fiscale | Other Gene ID | Sorgenti |
|---|---|---|---|---|---|---|
| Chimp | 463780 | NDUFB2 | NADH:ubiquinone oxidoreductase subunit B2 | 9598 | VGNC:4441 | Inparanoid, OMA, EggNOG |
| Macaque | 693431 | NDUFB2 | NADH:ubiquinone oxidoreductase subunit B2 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 68198 | Ndufb2 | NADH:ubiquinone oxidoreductase subunit B2 | 10090 | MGI:1915448 | Inparanoid, OMA, EggNOG |
| Rat | 362344 | Ndufb2 | NADH:ubiquinone oxidoreductase subunit B2 | 10116 | RGD:1308130 | Inparanoid, OMA, EggNOG |
| Dog | 100683846 | NDUFB2 | NADH:ubiquinone oxidoreductase subunit B2 | 9615 | VGNC:43701 | Inparanoid, OMA, EggNOG |
| Horse | 100064695 | NDUFB2 | NADH:ubiquinone oxidoreductase subunit B2 | 9796 | VGNC:20638 | Inparanoid, OMA, EggNOG |
| Cow | 327713 | NDUFB2 | NADH:ubiquinone oxidoreductase subunit B2 | 9913 | VGNC:31962 | Inparanoid, OMA, EggNOG |
| Pig | 100513895 | NDUFB2 | NADH:ubiquinone oxidoreductase subunit B2 | 9823 | Inparanoid, EggNOG | |
| Opossum | NDUFB2 | NADH:ubiquinone oxidoreductase subunit B2 [Source:HGNC Symbol;Acc:HGNC:7697] | 13616 | Inparanoid, OMA, EggNOG | ||
| Anole lizard | 100559985 | ndufb2 | NADH:ubiquinone oxidoreductase subunit B2 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 100127720 | ndufb2 | NADH:ubiquinone oxidoreductase subunit B2 | 8364 | XB-GENE-1009607 | Inparanoid, EggNOG |
| Zebrafish | 393764 | ndufb2 | NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 2 | 7955 | ZDB-GENE-040426-1762 | OMA, EggNOG |
Associated Recombinant Proteins
| Nome | Specification and purity | Expression system | Protein label | Disponibilità | Vedi dettagli |
|---|
Associated Antibodies
| Nome | Specifiche | Species reactivity | Applicazione | Disponibilità | Vedi dettagli |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nome | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Ricordamelo più tardi
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.