MKRN2

DescrizioneProbable E3 ubiquitin-protein ligase makorin-2

Gene and Protein Information

Gene ID23609
Uniprot Accession IDs Q9H000 A6NIA2 B3KRC5 B4DPR4 Q8N391 Q96BD4 Q9BUY2 Q9NRY1
Ensembl ID ENSP00000170447
Symbol RNF62 RNF62 HSPC070
Sequence
MSTKQITCRYFMHGVCREGSQCLFSHDLANSKPSTICKYYQKGYCAYGTRCRYDHTRPSAAAGGAVGTMAHSVPSPAFHSPHPPSEVTASIVKTNSHEPGKREKRTLVLRDRNLSGMAERKTQPSMVSNPGSCSDPQPSPEMKPHSYLDAIRSGLDDVEASSSYSNEQQLCPYAAAGECRFGDACVYLHGEVCEICRLQVLHPFDPEQRKAHEKICMLTFEHEMEKAFAFQASQDKVCSICMEVILEKASASERRFGILSNCNHTYCLSCIRQWRCAKQFENPIIKSCPECRVISEFVIPSVYWVEDQNKKNELIEAFKQGMGKKACKYFEQGKGTCPFGSKCLYRHAYPDGRLAEPEKPRKQLSSQGTVRFFNSVRLWDFIENRESRHVPNNEDVDMTELGDLFMHLSGVESSEP
Mostra altro
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp460180MKRN2makorin ring finger protein 29598VGNC:2048OMA, EggNOG
Macaque697649MKRN2makorin ring finger protein 29544Inparanoid, OMA, EggNOG
Mouse67027Mkrn2makorin, ring finger protein, 210090MGI:1914277Inparanoid, OMA, EggNOG
Rat297525Mkrn2makorin, ring finger protein, 210116RGD:1310618Inparanoid, OMA, EggNOG
Dog476531MKRN2makorin ring finger protein 29615VGNC:43252Inparanoid, OMA, EggNOG
Horse100057038MKRN2makorin ring finger protein 29796VGNC:20205Inparanoid, OMA
Cow508004MKRN2makorin ring finger protein 29913Inparanoid, OMA
Pig100626891MKRN2makorin ring finger protein 29823Inparanoid, OMA
Opossum100025193MKRN2makorin ring finger protein 213616Inparanoid, OMA
Chicken374162MKRN2makorin ring finger protein 29031CGNC:3707Inparanoid, OMA, EggNOG
Anole lizard100557415mkrn2makorin ring finger protein 228377Inparanoid, OMA, EggNOG
Zebrafish170783mkrn2makorin, ring finger protein, 27955ZDB-GENE-020213-2Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    ligase    /    ubiquitin-protein ligase    /    Probable E3 ubiquitin-protein ligase makorin-2
DTO Classes
protein    /    Enzyme    /    Ligase    /    Ubiquitin-protein ligase    /    Probable E3 ubiquitin-protein ligase makorin-2

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.