🌎 Spedisci a: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS / CoA struttura Massivo e personalizzato
Menu
Account
Impostazioni
྾
340,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

COX5B

DescrizioneCytochrome c oxidase subunit 5B, mitochondrial

Gene and Protein Information

Gene ID1329
Uniprot Accession IDs P10606 Q53YB7 Q96J18 Q99610
Ensembl ID ENSP00000258424
Symbol COXVB
FamilyBelongs to the cytochrome c oxidase subunit 5B family.
Sequence
MASRLLRGAGTLAAQALRARGPSGAAAMRSMASGGGVPTDEEQATGLEREIMLAAKKGLDPYNVLAPKGASGTREDPNLVPSISNKRIVGCICEEDNTSVVWFWLHKGEAQRCPRCGAHYKLVPQQLAH
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp741789COX5Bcytochrome c oxidase subunit 5B9598VGNC:10525OMA, EggNOG
Mouse12859Cox5bcytochrome c oxidase subunit Vb10090MGI:88475Inparanoid, OMA
Mouse100040340Gm11273predicted gene 1127310090MGI:3649411OMA, EggNOG
Rat94194Cox5bcytochrome c oxidase subunit 5B10116RGD:620608Inparanoid, OMA, EggNOG
Dog474567COX5Bcytochrome c oxidase subunit 5B9615VGNC:39540Inparanoid, OMA, EggNOG
Horse100061973COX5Bcytochrome c oxidase subunit 5B9796VGNC:16804Inparanoid, OMA, EggNOG
Cow287012COX5Bcytochrome c oxidase subunit Vb9913Inparanoid, OMA, EggNOG
Pig492822COX5Bmitochondrial cytochrome c oxidase subunit Vb9823Inparanoid, OMA, EggNOG
Anole lizard100563950LOC100563950cytochrome c oxidase subunit 5B, mitochondrial28377Inparanoid, OMA, EggNOG
Xenopus549004cox5b.1cytochrome c oxidase subunit Vb, gene 18364XB-GENE-964002OMA, EggNOG
Zebrafish415253zgc:86599zgc:865997955ZDB-GENE-040625-180Inparanoid, OMA, EggNOG
C. elegans172832cox-5BCytochrome OXidase assembly protein6239OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    oxidoreductase    /    oxidase    /    Cytochrome c oxidase subunit 5B, mitochondrial
DTO Classes
protein    /    Enzyme    /    Oxidoreductase    /    Oxidase    /    Cytochrome c oxidase subunit 5B, mitochondrial

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Utilizziamo i cookie per garantire il corretto funzionamento del sito web e, ove consentito, per migliorare la tua esperienza. Puoi gestire le tue preferenze in qualsiasi momento nelle Impostazioni. Per saperne di più, consulta la nostra Cookie Policy.

      Desidera che le inviamo un messaggio quando avremo sconti disponibili?

      Ricordamelo più tardi

      Grazie! Controlli la sua casella di posta per confermare.

      Ops! Le notifiche sono disabilitate.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.