🌎 Ship to: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS / CoA Structure Massivo e personalizzato
Menu
Account
Impostazioni
྾
224,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

BTF3

DescrizioneTranscription factor BTF3

Gene and Protein Information

Gene ID689
Uniprot Accession IDs P20290 A8K510 Q13893 Q76M56
Ensembl ID ENSP00000369965
Symbol NACB NACB BTF3a BTF3b BETA-NAC
FamilyBelongs to the NAC-beta family.
Sequence
MRRTGAPAQADSRGRGRARGGCPGGEATLSQPPPRGGTRGQEPQMKETIMNQEKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQFSLKKLGVNNISGIEEVNMFTNQGTVIHFNNPKVQASLAANTFTITGHAETKQLTEMLPSILNQLGADSLTSLRRLAEALPKQSVDGKAPLATGEDDDDEVPDLVENFDEASKNEAN
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp461812BTF3basic transcription factor 39598VGNC:3911OMA, EggNOG
Macaque703339BTF3basic transcription factor 39544Inparanoid, OMA, EggNOG
Mouse218490Btf3basic transcription factor 310090MGI:1202875Inparanoid, OMA, EggNOG
Rat294680Btf3basic transcription factor 310116RGD:1308095OMA, EggNOG
Dog608628BTF3basic transcription factor 39615VGNC:52111Inparanoid, OMA
Horse100065663BTF3basic transcription factor 39796VGNC:15917Inparanoid, OMA, EggNOG
Cow281031BTF3basic transcription factor 39913VGNC:26595Inparanoid, OMA, EggNOG
Pig100514824BTF3basic transcription factor 39823Inparanoid, OMA, EggNOG
Opossum100011346BTF3basic transcription factor 313616OMA, EggNOG
Platypus100082516BTF3basic transcription factor 39258Inparanoid, OMA, EggNOG
Chicken426154BTF3basic transcription factor 39031CGNC:10153Inparanoid, OMA, EggNOG
Anole lizard100556760btf3basic transcription factor 328377Inparanoid, OMA, EggNOG
Xenopus549451btf3basic transcription factor 38364XB-GENE-985803Inparanoid, OMA, EggNOG
Zebrafish556625btf3basic transcription factor 37955ZDB-GENE-030131-8731Inparanoid, OMA, EggNOG
C. elegans174090icd-1Transcription factor BTF3 homolog6239Inparanoid, OMA

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.