🌎 Ship to: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS CoA Structure
Menu
Account
Impostazioni
྾
224,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

CD8A

DescrizioneT-cell surface glycoprotein CD8 alpha chain

Gene and Protein Information

Gene ID925
Uniprot Accession IDs P01732 B4DT80 D6W5M8 Q13970 Q4ZG17
Ensembl ID ENSP00000386559
Symbol MAL CD8 p32 Leu2
Sequence
MALPVTALLLPLALLLHAARPSQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCNHRNRRRVCKCPRPVVKSGDKPSLSARYV
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp735755CD8ACD8a molecule9598VGNC:188OMA, EggNOG
Macaque698329CD8ACD8a molecule9544Inparanoid, OMA, EggNOG
Mouse12525Cd8aCD8 antigen, alpha chain10090MGI:88346Inparanoid, OMA, EggNOG
Rat24930Cd8aCD8a molecule10116RGD:2316Inparanoid, OMA, EggNOG
Dog403157CD8ACD8a molecule9615VGNC:38980Inparanoid, OMA, EggNOG
Horse100066774CD8ACD8a molecule9796VGNC:16282Inparanoid, OMA, EggNOG
Cow281060CD8ACD8a molecule9913VGNC:27052Inparanoid, OMA, EggNOG
Pig396627CD8ACD8a molecule9823Inparanoid, OMA, EggNOG
Opossum100029709CD8ACD8a molecule13616Inparanoid, EggNOG

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.