CD8A

DescrizioneT-cell surface glycoprotein CD8 alpha chain

Gene and Protein Information

Gene ID925
Uniprot Accession IDs P01732 B4DT80 D6W5M8 Q13970 Q4ZG17
Ensembl ID ENSP00000386559
Symbol MAL CD8 p32 Leu2
Sequence
MALPVTALLLPLALLLHAARPSQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCNHRNRRRVCKCPRPVVKSGDKPSLSARYV
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp735755CD8ACD8a molecule9598VGNC:188OMA, EggNOG
Macaque698329CD8ACD8a molecule9544Inparanoid, OMA, EggNOG
Mouse12525Cd8aCD8 antigen, alpha chain10090MGI:88346Inparanoid, OMA, EggNOG
Rat24930Cd8aCD8a molecule10116RGD:2316Inparanoid, OMA, EggNOG
Dog403157CD8ACD8a molecule9615VGNC:38980Inparanoid, OMA, EggNOG
Horse100066774CD8ACD8a molecule9796VGNC:16282Inparanoid, OMA, EggNOG
Cow281060CD8ACD8a molecule9913VGNC:27052Inparanoid, OMA, EggNOG
Pig396627CD8ACD8a molecule9823Inparanoid, OMA, EggNOG
Opossum100029709CD8ACD8a molecule13616Inparanoid, EggNOG

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.