🌎 Ship to: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS CoA Structure
Menu
Account
Impostazioni
྾
224,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

CD28

DescrizioneT-cell-specific surface glycoprotein CD28

Gene and Protein Information

Gene ID940
Uniprot Accession IDs P10747 A8KAC1 Q13964 Q52M23 Q70WG0 Q8NI54 Q8NI55 Q8NI56 Q8WXJ2 Q9BYV0
Ensembl ID ENSP00000324890
Symbol Tp44
Sequence
MLRLLLALNLFPSIQVTGNKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp470617CD28CD28 molecule9598VGNC:127OMA, EggNOG
Macaque705313CD28CD28 molecule9544Inparanoid, OMA, EggNOG
Mouse12487Cd28CD28 antigen10090MGI:88327Inparanoid, OMA, EggNOG
Rat25660Cd28Cd28 molecule10116RGD:2299Inparanoid, OMA, EggNOG
Dog403646CD28CD28 molecule9615VGNC:38944Inparanoid, OMA, EggNOG
Horse100067829CD28CD28 molecule9796VGNC:16257Inparanoid, OMA, EggNOG
Cow281050CD28CD28 molecule9913VGNC:27021Inparanoid, OMA, EggNOG
Pig100515419CD28CD28 molecule9823OMA, EggNOG
Opossum100017932CD28CD28 molecule13616Inparanoid, OMA, EggNOG
Platypus100082570CD28CD28 molecule9258Inparanoid, OMA, EggNOG
Chicken396249CD28CD28 molecule9031CGNC:6581Inparanoid, OMA, EggNOG
Anole lizard100566176cd28CD28 molecule28377Inparanoid, OMA, EggNOG
Xenopus100126210cd28CD28 molecule8364XB-GENE-489232Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.