CDK4

DescrizioneCyclin-dependent kinase 4

Gene and Protein Information

Gene ID1019
Uniprot Accession IDs P11802 B2R9A0 B4DNF9 O00576 Q6FG61
Ensembl ID ENSP00000257904
Symbol CMM3 PSK-J3
FamilyBelongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily.
Sequence
MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLPISTVREVALLRRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDLMRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE
Mostra altro
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp452025CDK4cyclin dependent kinase 49598VGNC:8366OMA, EggNOG
Macaque715650CDK4cyclin dependent kinase 49544Inparanoid, OMA, EggNOG
Mouse12567Cdk4cyclin-dependent kinase 410090MGI:88357Inparanoid, OMA, EggNOG
Rat94201Cdk4cyclin-dependent kinase 410116RGD:621120Inparanoid, OMA, EggNOG
Dog481131CDK4cyclin dependent kinase 49615VGNC:39054Inparanoid, OMA
Horse100051005CDK4cyclin dependent kinase 49796VGNC:16348Inparanoid, OMA
Cow510618CDK4cyclin dependent kinase 49913Inparanoid, OMA
Pig100144492CDK4cyclin dependent kinase 49823Inparanoid, OMA
Anole lizard100559515cdk4cyclin dependent kinase 428377Inparanoid, OMA
Zebrafish777730cdk4cyclin-dependent kinase 47955ZDB-GENE-060929-974Inparanoid, OMA

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.