🌎 Ship to: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS / CoA Structure Massivo e personalizzato
Menu
Account
Impostazioni
྾
224,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

GJA5

DescrizioneGap junction alpha-5 protein

Gene and Protein Information

Gene ID2702
Uniprot Accession IDs P36382 Q5T3B6 Q5U0N6
Ensembl ID ENSP00000484552
Symbol CX40 ATFB11
FamilyBelongs to the connexin family. Alpha-type (group II) subfamily.
Sequence
MGDWSFLGNFLEEVHKHSTVVGKVWLTVLFIFRMLVLGTAAESSWGDEQADFRCDTIQPGCQNVCYDQAFPISHIRYWVLQIIFVSTPSLVYMGHAMHTVRMQEKRKLREAERAKEVRGSGSYEYPVAEKAELSCWEEGNGRIALQGTLLNTYVCSILIRTTMEVGFIVGQYFIYGIFLTTLHVCRRSPCPHPVNCYVSRPTEKNVFIVFMLAVAALSLLLSLAELYHLGWKKIRQRFVKPRQHMAKCQLSGPSVGIVQSCTPPPDFNQCLENGPGGKFFNPFSNNMASQQNTDNLVTEQVRGQEQTPGEGFIQVRYGQKPEVPNGVSPGHRLPHGYHSDKRRLSKASSKARSDDLSV
Mostra altro
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Macaque701163GJA5gap junction protein alpha 59544Inparanoid, OMA
Mouse14613Gja5gap junction protein, alpha 510090MGI:95716Inparanoid, OMA
Rat50563Gja5gap junction protein, alpha 510116RGD:2692Inparanoid, OMA
Dog483155GJA5gap junction protein alpha 59615VGNC:41235Inparanoid, OMA
Horse100065052GJA5gap junction protein alpha 59796VGNC:18352Inparanoid, OMA
Cow539491GJA5gap junction protein alpha 59913VGNC:29374Inparanoid, OMA
Opossum100012487GJA5gap junction protein alpha 513616Inparanoid, OMA
Anole lizard100561629gja5gap junction protein alpha 528377Inparanoid, OMA
Xenopus100489536gja5gap junction protein alpha 58364XB-GENE-490481Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    cell junction protein    /    gap junction    /    Gap junction alpha-5 protein
DTO Classes
protein    /    Cell-cell junction    /    Gap junction    /    Gap junction alpha-5 protein

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.