GJD3

DescrizioneGap junction delta-3 protein

Gene and Protein Information

Gene ID125111
Uniprot Accession IDs Q8N144 Q6ZUW6
Ensembl ID ENSP00000463752
Symbol GJA11 GJC1 GJC1 GJA11 CX31.9 Cx30.2
FamilyBelongs to the connexin family. Delta-type subfamily.
Sequence
MGEWAFLGSLLDAVQLQSPLVGRLWLVVMLIFRILVLATVGGAVFEDEQEEFVCNTLQPGCRQTCYDRAFPVSHYRFWLFHILLLSAPPVLFVVYSMHRAGKEAGGAEAAAQCAPGLPEAQCAPCALRARRARRCYLLSVALRLLAELTFLGGQALLYGFRVAPHFACAGPPCPHTVDCFVSRPTEKTVFVLFYFAVGLLSALLSVAELGHLLWKGRPRAGERDNRCNRAHEEAQKLLPPPPPPPPPPALPSRRPGPEPCAPPAYAHPAPASLRECGSGRGKASPATGRRDLAI
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp745773GJD3gap junction protein delta 39598VGNC:12222Inparanoid, OMA
Macaque700473GJD3gap junction protein delta 39544Inparanoid, OMA
Mouse353155Gjd3gap junction protein, delta 310090MGI:2384150Inparanoid, OMA
Rat363677Gjd3gap junction protein, delta 310116RGD:1308942Inparanoid, OMA
OpossumGJD3gap junction protein delta 3 [Source:HGNC Symbol;Acc:HGNC:19147]13616Inparanoid, OMA
Anole lizard100567861gjd3gap junction protein delta 328377Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    cell junction protein    /    gap junction    /    Gap junction delta-3 protein
DTO Classes
protein    /    Cell-cell junction    /    Gap junction    /    Gap junction delta-3 protein

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.