🌎 Spedisci a: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS / CoA struttura Massivo e personalizzato
Menu
Account
Impostazioni
྾
340,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

CEBPE

DescrizioneCCAAT/enhancer-binding protein epsilon

Gene and Protein Information

Gene ID1053
Uniprot Accession IDs Q15744 Q15745 Q8IYI2 Q99803 C/EBP epsilon
Ensembl ID ENSP00000206513
Symbol CRP1 C/EBP-epsilon
FamilyBelongs to the bZIP family. C/EBP subfamily.
Sequence
MSHGTYYECEPRGGQQPLEFSGGRAGPGELGDMCEHEASIDLSAYIESGEEQLLSDLFAVKPAPEARGLKGPGTPAFPHYLPPDPRPFAYPPHTFGPDRKALGPGIYSSPGSYDPRAVAVKEEPRGPEGSRAASRGSYNPLQYQVAHCGQTAMHLPPTLAAPGQPLRVLKAPLATAAPPCSPLLKAPSPAGPLHKGKKAVNKDSLEYRLRRERNNIAVRKSRDKAKRRILETQQKVLEYMAENERLRSRVEQLTQELDTLRNLFRQIPEAANLIKGVGGCS
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp743538CEBPECCAAT enhancer binding protein epsilon9598VGNC:8195OMA, EggNOG
Macaque713442CEBPECCAAT/enhancer binding protein epsilon9544Inparanoid, OMA, EggNOG
Mouse110794CebpeCCAAT/enhancer binding protein (C/EBP), epsilon10090MGI:103572Inparanoid, OMA
Rat25410CebpeCCAAT/enhancer binding protein epsilon10116RGD:2329Inparanoid, OMA
Horse100052512CEBPECCAAT enhancer binding protein epsilon9796VGNC:16381Inparanoid, OMA
Cow534346CEBPECCAAT enhancer binding protein epsilon9913VGNC:27162Inparanoid, OMA
Anole lizard100554198cebpeCCAAT/enhancer binding protein epsilon28377Inparanoid, OMA
XenopusCEBPECCAAT/enhancer binding protein epsilon [Source:HGNC Symbol;Acc:HGNC:1836]8364OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    transcription factor    /    basic leucine zipper transcription factor    /    CCAAT/enhancer-binding protein epsilon
protein    /    transcription factor    /    nucleic acid binding    /    CCAAT/enhancer-binding protein epsilon
DTO Classes
protein    /    Transcription factor    /    Basic leucine zipper transcription factor    /    CCAAT/enhancer-binding protein epsilon

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificheSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Utilizziamo i cookie per garantire il corretto funzionamento del sito web e, ove consentito, per migliorare la tua esperienza. Puoi gestire le tue preferenze in qualsiasi momento nelle Impostazioni. Per saperne di più, consulta la nostra Cookie Policy.

      Desidera che le inviamo un messaggio quando avremo sconti disponibili?

      Ricordamelo più tardi

      Grazie! Controlli la sua casella di posta per confermare.

      Ops! Le notifiche sono disabilitate.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.