🌎 Spedisci a: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS / CoA struttura Massivo e personalizzato
Menu
Account
Impostazioni
྾
340,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

CEBPA

DescrizioneCCAAT/enhancer-binding protein alpha

Gene and Protein Information

Gene ID1050
Uniprot Accession IDs P49715 A7LNP2 P78319 Q05CA4 C/EBP alpha
Ensembl ID ENSP00000427514
Symbol CEBP CEBP C/EBP-alpha
FamilyBelongs to the bZIP family. C/EBP subfamily.
Sequence
MESADFYEAEPRPPMSSHLQSPPHAPSSAAFGFPRGAGPAQPPAPPAAPEPLGGICEHETSIDISAYIDPAAFNDEFLADLFQHSRQQEKAKAAVGPTGGGGGGDFDYPGAPAGPGGAVMPGGAHGPPPGYGCAAAGYLDGRLEPLYERVGAPALRPLVIKQEPREEDEAKQLALAGLFPYQPPPPPPPSHPHPHPPPAHLAAPHLQFQIAHCGQTTMHLQPGHPTPPPTPVPSPHPAPALGAAGLPGPGSALKGLGAAHPDLRASGGSGAGKAKKSVDKNSNEYRVRRERNNIAVRKSRDKAKQRNVETQQKVLELTSDNDRLRKRVEQLSRELDTLRGIFRQLPESSLVKAMGNCA
Mostra altro
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Mouse12606CebpaCCAAT/enhancer binding protein (C/EBP), alpha10090MGI:99480Inparanoid, OMA, EggNOG
Rat24252CebpaCCAAT/enhancer binding protein alpha10116RGD:2326Inparanoid, OMA, EggNOG
Pig397307CEBPACCAAT/enhancer binding protein alpha9823Inparanoid, OMA, EggNOG
PlatypusCEBPACCAAT/enhancer binding protein alpha [Source:HGNC Symbol;Acc:HGNC:1833]9258OMA, EggNOG
Xenopus496454cebpaCCAAT enhancer binding protein alpha8364XB-GENE-853397Inparanoid, OMA
Zebrafish140815cebpaCCAAT enhancer binding protein alpha7955ZDB-GENE-020111-2Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    transcription factor    /    basic leucine zipper transcription factor    /    CCAAT/enhancer-binding protein alpha
protein    /    transcription factor    /    nucleic acid binding    /    CCAAT/enhancer-binding protein alpha
DTO Classes
protein    /    Transcription factor    /    Basic leucine zipper transcription factor    /    CCAAT/enhancer-binding protein alpha

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificheSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Utilizziamo i cookie per garantire il corretto funzionamento del sito web e, ove consentito, per migliorare la tua esperienza. Puoi gestire le tue preferenze in qualsiasi momento nelle Impostazioni. Per saperne di più, consulta la nostra Cookie Policy.

      Desidera che le inviamo un messaggio quando avremo sconti disponibili?

      Ricordamelo più tardi

      Grazie! Controlli la sua casella di posta per confermare.

      Ops! Le notifiche sono disabilitate.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.