🌎 Ship to: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS CoA Structure
Menu
Account
Impostazioni
྾
224,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

CDK5

DescrizioneCyclin-dependent-like kinase 5

Gene and Protein Information

Gene ID1020
Uniprot Accession IDs Q00535 A1XKG3
Ensembl ID ENSP00000419782
Symbol CDKN5 LIS7 PSSALRE
FamilyBelongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily.
Sequence
MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp463891CDK5cyclin dependent kinase 59598VGNC:7364OMA, EggNOG
Macaque714445CDK5cyclin dependent kinase 59544Inparanoid, OMA, EggNOG
Mouse12568Cdk5cyclin-dependent kinase 510090MGI:101765Inparanoid, OMA, EggNOG
Rat140908Cdk5cyclin-dependent kinase 510116RGD:70514Inparanoid, OMA
Dog475537CDK5cyclin dependent kinase 59615VGNC:51795Inparanoid, OMA, EggNOG
Horse100063442CDK5cyclin dependent kinase 59796VGNC:16349Inparanoid, OMA, EggNOG
Cow281066CDK5cyclin dependent kinase 59913VGNC:27127Inparanoid, OMA, EggNOG
Pig733700CDK5cyclin dependent kinase 59823Inparanoid, OMA, EggNOG
Opossum100015241CDK5cyclin dependent kinase 513616Inparanoid, OMA, EggNOG
Xenopus780236cdk5cyclin-dependent kinase 58364XB-GENE-1010261Inparanoid, OMA, EggNOG
Zebrafish65234cdk5cyclin-dependent kinase 57955ZDB-GENE-010131-2Inparanoid, OMA, EggNOG
C. elegans176774cdk-5Cyclin-dependent-like kinase 56239Inparanoid, OMA
Fruitfly36727Cdk5Cyclin-dependent kinase 57227FBgn0013762Inparanoid, OMA

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.