🌎 Ship to: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS CoA Structure
Menu
Account
Impostazioni
྾
224,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

CYP46A1

DescrizioneCholesterol 24-hydroxylase

Gene and Protein Information

Gene ID10858
Uniprot Accession IDs Q9Y6A2 B4DHP8 E7EQG9 Q8N2B0 CH24H
Ensembl ID ENSP00000261835
Symbol CYP46 CP46 CYP46
FamilyBelongs to the cytochrome P450 family.
Sequence
MSPGLLLLGSAVLLAFGLCCTFVHRARSRYEHIPGPPRPSFLLGHLPCFWKKDEVGGRVLQDVFLDWAKKYGPVVRVNVFHKTSVIVTSPESVKKFLMSTKYNKDSKMYRALQTVFGERLFGQGLVSECNYERWHKQRRVIDLAFSRSSLVSLMETFNEKAEQLVEILEAKADGQTPVSMQDMLTYTAMDILAKAAFGMETSMLLGAQKPLSQAVKLMLEGITASRNTLAKFLPGKRKQLREVRESIRFLRQVGRDWVQRRREALKRGEEVPADILTQILKAEEGAQDDEGLLDNFVTFFIAGHETSANHLAFTVMELSRQPEIVARLQAEVDEVIGSKRYLDFEDLGRLQYLSQVLKESLRLYPPAWGTFRLLEEETLIDGVRVPGNTPLLFSTYVMGRMDTYFEDPLTFNPDRFGPGAPKPRFTYFPFSLGHRSCIGQQFAQMEVKVVMAKLLQRLEFRLVPGQRFGLQEQATLKPLDPVLCTLRPRGWQPAPPPPPC
Mostra altro
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp453154CYP46A1cytochrome P450 family 46 subfamily A member 19598VGNC:7521OMA, EggNOG
Macaque705843LOC705843cholesterol 24-hydroxylase9544OMA, EggNOG
Mouse13116Cyp46a1cytochrome P450, family 46, subfamily a, polypeptide 110090MGI:1341877Inparanoid, OMA, EggNOG
Rat362782Cyp46a1cytochrome P450, family 46, subfamily a, polypeptide 110116RGD:1306605Inparanoid, OMA
Dog480432CYP46A1cytochrome P450 family 46 subfamily A member 19615VGNC:50360Inparanoid, OMA, EggNOG
Horse100051131LOC100051131cholesterol 24-hydroxylase9796OMA, EggNOG
CowCYP46A1cytochrome P450 family 46 subfamily A member 1 [Source:HGNC Symbol;Acc:HGNC:2641]9913OMA, EggNOG
Pig100512793LOC100512793cholesterol 24-hydroxylase9823Inparanoid, OMA, EggNOG
Chicken423450CYP46A1cytochrome P450 family 46 subfamily A member 19031CGNC:8476Inparanoid, OMA, EggNOG
Anole lizard100552607LOC100552607cholesterol 24-hydroxylase28377OMA, EggNOG
Anole lizard100552409LOC100552409cholesterol 24-hydroxylase28377Inparanoid, OMA
Xenopus613109mgc108213uncharacterized protein mgc1082138364XB-GENE-969052OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    oxidoreductase    /    oxygenase    /    Cholesterol 24-hydroxylase
DTO Classes
protein    /    Enzyme    /    Oxidoreductase    /    Oxygenase    /    Cholesterol 24-hydroxylase

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.