CRY2

DescrizioneCryptochrome-2

Gene and Protein Information

Gene ID1408
Uniprot Accession IDs Q49AN0 B4DH32 B4DZD6 O75148 Q8IV71
Ensembl ID ENSP00000478187
Symbol KIAA0658 HCRY2 PHLL2
FamilyBelongs to the DNA photolyase class-1 family.
Sequence
MAATVATAAAVAPAPAPGTDSASSVHWFRKGLRLHDNPALLAAVRGARCVRCVYILDPWFAASSSVGINRWRFLLQSLEDLDTSLRKLNSRLFVVRGQPADVFPRLFKEWGVTRLTFEYDSEPFGKERDAAIMKMAKEAGVEVVTENSHTLYDLDRIIELNGQKPPLTYKRFQAIISRMELPKKPVGLVTSQQMESCRAEIQENHDETYGVPSLEELGFPTEGLGPAVWQGGETEALARLDKHLERKAWVANYERPRMNANSLLASPTGLSPYLRFGCLSCRLFYYRLWDLYKKVKRNSTPPLSLFGQLLWREFFYTAATNNPRFDRMEGNPICIQIPWDRNPEALAKWAEGKTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRGDLWVSWESGVRVFDELLLDADFSVNAGSWMWLSCSAFFQQFFHCYCPVGFGRRTDPSGDYIRRYLPKLKAFPSRYIYEPWNAPESIQKAAKCIIGVDYPRPIVNHAETSRLNIERMKQIYQQLSRYRGLCLLASVPSCVEDLSHPVAEPSSSQAGSMSSAGPRPLPSGPASPKRKLEAAEEPPGEELSKRARVAELPTPELPSKDA
Mostra altro
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp742186CRY2cryptochrome circadian regulator 29598VGNC:3142OMA, EggNOG
Macaque715000CRY2cryptochrome circadian regulator 29544Inparanoid, OMA, EggNOG
Mouse12953Cry2cryptochrome 2 (photolyase-like)10090MGI:1270859Inparanoid, OMA, EggNOG
Rat170917Cry2cryptochrome circadian regulator 210116RGD:620935Inparanoid, OMA, EggNOG
Dog483641CRY2cryptochrome circadian regulator 29615VGNC:39634Inparanoid, OMA, EggNOG
Horse100056637CRY2cryptochrome circadian regulator 29796VGNC:16881Inparanoid, OMA, EggNOG
Cow509058CRY2cryptochrome circadian regulator 29913VGNC:27731OMA, EggNOG
Pig100517750CRY2cryptochrome circadian regulator 29823Inparanoid, OMA, EggNOG
Opossum100618618CRY2cryptochrome circadian regulator 213616Inparanoid, OMA, EggNOG
PlatypusCRY2cryptochrome circadian regulator 2 [Source:HGNC Symbol;Acc:HGNC:2385]9258OMA, EggNOG
Chicken374092CRY2cryptochrome circadian clock 29031CGNC:6396Inparanoid, OMA
Anole lizard100559432cry2cryptochrome circadian regulator 228377Inparanoid, OMA
S.cerevisiae854568PHR1deoxyribodipyrimidine photo-lyase PHR14932S000005913Inparanoid, EggNOG

Protein Classes

PANTHER Classes
protein    /    nucleic acid binding    /    DNA photolyase    /    Cryptochrome-2
protein    /    nucleic acid binding    /    lyase    /    Cryptochrome-2
DTO Classes
protein    /    Enzyme    /    Lyase    /    DNA photolyase    /    Cryptochrome-2

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.