🌎 Ship to: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS / CoA Structure Massivo e personalizzato
Menu
Account
Impostazioni
྾
224,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

COPS5

DescrizioneCOP9 signalosome complex subunit 5

Gene and Protein Information

Gene ID10987
Uniprot Accession IDs Q92905 O15386 Q6AW95 Q86WQ4 Q9BQ17 SGN5
Ensembl ID ENSP00000350512
Symbol CSN5 JAB1 CSN5 JAB1 SGN5 MOV-34
FamilyBelongs to the peptidase M67A family. CSN5 subfamily.
Sequence
MAASGSGMAQKTWELANNMQEAQSIDEIYKYDKKQQQEILAAKPWTKDHHYFKYCKISALALLKMVMHARSGGNLEVMGLMLGKVDGETMIIMDSFALPVEGTETRVNAQAAAYEYMAAYIENAKQVGRLENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYPKGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSFMLGLETHDRKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQINIS
Mostra altro
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp744682COPS5COP9 signalosome subunit 59598VGNC:911OMA, EggNOG
Macaque704584COPS5COP9 signalosome subunit 59544Inparanoid, OMA, EggNOG
Mouse26754Cops5COP9 signalosome subunit 510090MGI:1349415Inparanoid, OMA, EggNOG
Rat312916Cops5COP9 signalosome subunit 510116RGD:1310301Inparanoid, OMA, EggNOG
Dog477901COPS5COP9 signalosome subunit 59615VGNC:54110Inparanoid, OMA, EggNOG
Horse100051846COPS5COP9 signalosome subunit 59796VGNC:16774Inparanoid, OMA, EggNOG
Cow507179COPS5COP9 signalosome subunit 59913VGNC:27602Inparanoid, OMA, EggNOG
Pig100125955COPS5COP9 signalosome subunit 59823Inparanoid, OMA, EggNOG
Opossum100021238COPS5COP9 signalosome subunit 513616Inparanoid, OMA, EggNOG
Platypus100079191COPS5COP9 signalosome subunit 59258Inparanoid, OMA, EggNOG
Anole lizard100554677cops5COP9 signalosome subunit 528377Inparanoid, OMA, EggNOG
Xenopus394714cops5COP9 signalosome subunit 58364XB-GENE-952827Inparanoid, OMA, EggNOG
Zebrafish393698cops5COP9 signalosome subunit 57955ZDB-GENE-040426-1686Inparanoid, OMA, EggNOG
C. elegans177342csn-5COP9 signalosome complex subunit 56239Inparanoid, OMA
Fruitfly42000CSN5COP9 signalosome subunit 57227FBgn0027053Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.