🌎 Ship to: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS / CoA Structure Massivo e personalizzato
Menu
Account
Impostazioni
྾
224,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

CTPS1

DescrizioneCTP synthase 1

Gene and Protein Information

Gene ID1503
Uniprot Accession IDs P17812 B4DR64 D3DPW1 Q5VW67 Q96GK6
Ensembl ID ENSP00000361704
Symbol CTPS CTPS GATD5 IMD24
FamilyBelongs to the CTP synthase family.
Sequence
MKYILVTGGVISGIGKGIIASSVGTILKSCGLHVTSIKIDPYINIDAGTFSPYEHGEVFVLDDGGEVDLDLGNYERFLDIRLTKDNNLTTGKIYQYVINKERKGDYLGKTVQVVPHITDAIQEWVMRQALIPVDEDGLEPQVCVIELGGTVGDIESMPFIEAFRQFQFKVKRENFCNIHVSLVPQPSSTGEQKTKPTQNSVRELRGLGLSPDLVVCRCSNPLDTSVKEKISMFCHVEPEQVICVHDVSSIYRVPLLLEEQGVVDYFLRRLDLPIERQPRKMLMKWKEMADRYDRLLETCSIALVGKYTKFSDSYASVIKALEHSALAINHKLEIKYIDSADLEPITSQEEPVRYHEAWQKLCSAHGVLVPGGFGVRGTEGKIQAIAWARNQKKPFLGVCLGMQLAVVEFSRNVLGWQDANSTEFDPTTSHPVVVDMPEHNPGQMGGTMRLGKRRTLFQTKNSVMRKLYGDADYLEERHRHRFEVNPVWKKCLEEQGLKFVGQDVEGERMEIVELEDHPFFVGVQYHPEFLSRPIKPSPPYFGLLLASVGRLSHYLQKGCRLSPRDTYSDRSGSSSPDSEITELKFPSINHD
Mostra altro
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp469296CTPS1CTP synthase 19598VGNC:513OMA, EggNOG
Macaque695498CTPS1CTP synthase 19544OMA, EggNOG
Mouse51797Ctpscytidine 5'-triphosphate synthase10090MGI:1858304Inparanoid, OMA, EggNOG
Rat313560Ctps1CTP synthase 110116RGD:1311060OMA, EggNOG
Dog100687720CTPS1CTP synthase 19615VGNC:39704Inparanoid, OMA, EggNOG
Horse100053845CTPS1CTP synthase 19796VGNC:16943Inparanoid, OMA, EggNOG
Cow506131CTPS1CTP synthase 19913VGNC:27808OMA, EggNOG
Pig100525292CTPS1CTP synthase 19823OMA, EggNOG
Opossum100026303CTPS1CTP synthase 113616Inparanoid, OMA, EggNOG
Platypus100084304CTPS1CTP synthase 19258Inparanoid, OMA, EggNOG
Anole lizard100553732ctps1CTP synthase 128377Inparanoid, OMA, EggNOG
Zebrafish445245ctps1bCTP synthase 1b7955ZDB-GENE-040801-160Inparanoid, OMA
C. elegans189267ctps-1CTP synthase6239Inparanoid, OMA, EggNOG
S.cerevisiae852241URA7CTP synthase URA74932S000000135OMA, EggNOG

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.