🌎 Ship to: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS CoA Structure
Menu
Account
Impostazioni
྾
224,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

PTPN7

DescrizioneTyrosine-protein phosphatase non-receptor type 7

Gene and Protein Information

Gene ID5778
Uniprot Accession IDs P35236 B3KXE1 Q53XK4 Q5SXQ0 Q5SXQ1 Q9BV05
Ensembl ID ENSP00000309116
Symbol LPTP HEPTP PTPNI BPTP-4 LC-PTP
FamilyBelongs to the protein-tyrosine phosphatase family. Non-receptor class subfamily.
Sequence
MVQAHGGRSRAQPLTLSLGAAMTQPPPEKTPAKKHVRLQERRGSNVALMLDVRSLGAVEPICSVNTPREVTLHFLRTAGHPLTRWALQRQPPSPKQLEEEFLKIPSNFVSPEDLDIPGHASKDRYKTILPNPQSRVCLGRAQSQEDGDYINANYIRGYDGKEKVYIATQGPMPNTVSDFWEMVWQEEVSLIVMLTQLREGKEKCVHYWPTEEETYGPFQIRIQDMKECPEYTVRQLTIQYQEERRSVKHILFSAWPDHQTPESAGPLLRLVAEVEESPETAAHPGPIVVHCSAGIGRTGCFIATRIGCQQLKARGEVDILGIVCQLRLDRGGMIQTAEQYQFLHHTLALYAGQLPEEPSP
Mostra altro
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp739158PTPN7protein tyrosine phosphatase, non-receptor type 79598VGNC:9887OMA, EggNOG
Macaque706254PTPN7protein tyrosine phosphatase, non-receptor type 79544Inparanoid, OMA, EggNOG
Mouse320139Ptpn7protein tyrosine phosphatase, non-receptor type 710090MGI:2156893Inparanoid, OMA, EggNOG
Rat246781Ptpn7protein tyrosine phosphatase, non-receptor type 710116RGD:708516Inparanoid, OMA, EggNOG
Dog607227PTPN7protein tyrosine phosphatase, non-receptor type 79615VGNC:45180Inparanoid, OMA, EggNOG
Horse100052261PTPN7protein tyrosine phosphatase, non-receptor type 79796VGNC:22024Inparanoid, OMA, EggNOG
Cow614077PTPN7protein tyrosine phosphatase, non-receptor type 79913VGNC:33542Inparanoid, OMA, EggNOG
Opossum100014659PTPN7protein tyrosine phosphatase, non-receptor type 713616Inparanoid, OMA, EggNOG
Platypus100077157PTPN7protein tyrosine phosphatase, non-receptor type 79258Inparanoid, OMA, EggNOG
Anole lizard100567068ptpn7protein tyrosine phosphatase, non-receptor type 728377Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.