🌎 Ship to: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS / CoA Structure Massivo e personalizzato
Menu
Account
Impostazioni
྾
224,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

PTPA

DescrizioneSerine/threonine-protein phosphatase 2A activator

Gene and Protein Information

Gene ID5524
Uniprot Accession IDs Q15257 A2A347 A9IZU4 B4DXM4 Q15258 Q53GZ3 Q5TZQ2 Q9BUK1 Q9NNZ7 Q9NNZ8 Q9NNZ9
Ensembl ID ENSP00000377036
Symbol PPP2R4 PP2A PR53 PPP2R4
FamilyBelongs to the PTPA-type PPIase family.
Sequence
MAEGERQPPPDSSEEAPPATQNFIIPKKEIHTVPDMGKWKRSQAYADYIGFILTLNEGVKGKKLTFEYRVSEMWNEVHEEKEQAAKQSVSCDECIPLPRAGHCAPSEAIEKLVALLNTLDRWIDETPPVDQPSRFGNKAYRTWYAKLDEEAENLVATVVPTHLAAAVPEVAVYLKESVGNSTRIDYGTGHEAAFAAFLCCLCKIGVLRVDDQIAIVFKVFNRYLEVMRKLQKTYRMEPAGSQGVWGLDDFQFLPFIWGSSQLIDHPYLEPRHFVDEKAVNENHKDYMFLECILFITEMKTGPFAEHSNQLWNISAVPSWSKVNQGLIRMYKAECLEKFPVIQHFKFGSLLPIHPVTSG
Mostra altro
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp107976795PTPAprotein phosphatase 2 phosphatase activator9598VGNC:4828OMA, EggNOG
Macaque716874PTPAprotein phosphatase 2 phosphatase activator9544OMA, EggNOG
Mouse110854Ptpaprotein phosphatase 2 protein activator10090MGI:1346006Inparanoid, OMA, EggNOG
Rat362102Ptpaprotein phosphatase 2 phosphatase activator10116RGD:1308354OMA, EggNOG
Dog491303PTPAprotein phosphatase 2 phosphatase activator9615VGNC:45164OMA, EggNOG
Horse100070047PTPAprotein phosphatase 2 phosphatase activator9796VGNC:22007OMA, EggNOG
Cow514460PTPAprotein phosphatase 2 phosphatase activator9913VGNC:33526Inparanoid, OMA, EggNOG
Pig100157517PTPAprotein phosphatase 2 phosphatase activator9823OMA, EggNOG
Platypus100077508PTPAprotein phosphatase 2 phosphatase activator9258OMA, EggNOG
Anole lizard100566267ptpaprotein phosphatase 2 phosphatase activator28377OMA, EggNOG
Xenopus100125159ptpaprotein phosphatase 2 phosphatase activator8364XB-GENE-970102OMA, EggNOG
Zebrafish445031ptpaprotein phosphatase 2 phosphatase activator7955ZDB-GENE-040801-11OMA, EggNOG
C. elegans175395Y71H2AM.20Serine/threonine-protein phosphatase 2A activator6239OMA, EggNOG
Fruitfly33555PtpaPhosphotyrosyl phosphatase activator7227FBgn0016698Inparanoid, EggNOG
S.cerevisiae854653RRD1peptidylprolyl isomerase RRD14932S000001415Inparanoid, EggNOG

Protein Classes

PANTHER Classes
protein    /    enzyme modulator    /    phosphatase activator    /    Serine/threonine-protein phosphatase 2A activator
DTO Classes
protein    /    Enzyme modulator    /    Phosphatase modulator    /    Phosphatase activator    /    Serine/threonine-protein phosphatase 2A activator

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.