RAB1B

DescrizioneRas-related protein Rab-1B

Gene and Protein Information

Gene ID81876
Uniprot Accession IDs Q9H0U4 A8K7S1
Ensembl ID ENSP00000310226
FamilyBelongs to the small GTPase superfamily. Rab family.
Sequence
MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESYANVKQWLQEIDRYASENVNKLLVGNKSDLTTKKVVDNTTAKEFADSLGIPFLETSAKNATNVEQAFMTMAAEIKKRMGPGAASGGERPNLKIDSTPVKPAGGGCC
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Mouse76308Rab1bRAB1B, member RAS oncogene family10090MGI:1923558Inparanoid, OMA
Dog610762RAB1BRAB1B, member RAS oncogene family9615VGNC:52037Inparanoid, OMA
Horse100058091RAB1BRAB1B, member RAS oncogene family9796Inparanoid, OMA
Cow540685RAB1BRAB1B, member RAS oncogene family9913Inparanoid, OMA
Opossum100015981RAB1BRAB1B, member RAS oncogene family13616Inparanoid, OMA

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.