🌎 Ship to: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS / CoA Structure Massivo e personalizzato
Menu
Account
Impostazioni
྾
224,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

EBAG9

DescrizioneReceptor-binding cancer antigen expressed on SiSo cells

Gene and Protein Information

Gene ID9166
Uniprot Accession IDs O00559 A8K3N6 Q5Y8C7 Q6IB20 Q9BS76
Ensembl ID ENSP00000337675
Symbol RCAS1 EB9 PDAF
Sequence
MAITQFRLFKFCTCLATVFSFLKRLICRSGRGRKLSGDQITLPTTVDYSSVPKQTDVEEWTSWDEDAPTSVKIEGGNGNVATQQNSLEQLEPDYFKDMTPTIRKTQKIVIKKREPLNFGIPDGSTGFSSRLAATQDLPFIHQSSELGDLDTWQENTNAWEEEEDAAWQAEEVLRQQKLADREKRAAEQQRKKMEKEAQRLMKKEQNKIGVKLS
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp464339EBAG9estrogen receptor binding site associated, antigen, 99598OMA, EggNOG
Macaque699305EBAG9estrogen receptor binding site associated, antigen, 99544Inparanoid, OMA, EggNOG
Mouse55960Ebag9estrogen receptor-binding fragment-associated gene 910090MGI:1859920Inparanoid, OMA, EggNOG
Rat299864Ebag9estrogen receptor binding site associated, antigen, 910116RGD:1307293Inparanoid, OMA
Dog403500EBAG9estrogen receptor binding site associated, antigen, 99615VGNC:40174Inparanoid, OMA, EggNOG
Horse100064267EBAG9estrogen receptor binding site associated, antigen, 99796VGNC:17395Inparanoid, OMA, EggNOG
Cow538551EBAG9estrogen receptor binding site associated, antigen, 99913Inparanoid, OMA, EggNOG
Pig100156275EBAG9estrogen receptor binding site associated, antigen, 99823OMA, EggNOG
Opossum100024590EBAG9estrogen receptor binding site associated, antigen, 913616OMA, EggNOG
Platypus100075604EBAG9estrogen receptor binding site associated, antigen, 99258OMA, EggNOG
Anole lizard100566802ebag9estrogen receptor binding site associated, antigen, 928377Inparanoid, OMA, EggNOG
Xenopus549842ebag9estrogen receptor binding site associated, antigen, 98364XB-GENE-996539Inparanoid, OMA, EggNOG
Zebrafish394069ebag9estrogen receptor binding site associated, antigen, 97955ZDB-GENE-040426-1093Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.