🌎 Ship to: United States
Toggle Nav
Carrello
Cerca
Spedizione in giornata per tutti gli articoli disponibili in magazzino.
Ricerca avanzata
Ordine rapido SDS / CoA Structure Massivo e personalizzato
Menu
Account
Impostazioni
྾
224,000+ prodotti di ricerca · Triple ISO certified · COA & SDS Disponibile per ogni prodotto · Spedizione lo stesso giorno su articoli in magazzino

UQCRC2

DescrizioneCytochrome b-c1 complex subunit 2, mitochondrial

Gene and Protein Information

Gene ID7385
Uniprot Accession IDs P22695 B3KSN4 Q9BQ05
Ensembl ID ENSP00000268379
Symbol QCR2 UQCR2 MC3DN5
FamilyBelongs to the peptidase M16 family. UQCRC2/QCR2 subfamily.
Sequence
MKLLTRAGSFSRFYSLKVAPKVKATAAPAGAPPQPQDLEFTKLPNGLVIASLENYSPVSRIGLFIKAGSRYEDFSNLGTTHLLRLTSSLTTKGASSFKITRGIEAVGGKLSVTATRENMAYTVECLRGDVDILMEFLLNVTTAPEFRRWEVADLQPQLKIDKAVAFQNPQTHVIENLHAAAYRNALANPLYCPDYRIGKVTSEELHYFVQNHFTSARMALIGLGVSHPVLKQVAEQFLNMRGGLGLSGAKANYRGGEIREQNGDSLVHAAFVAESAVAGSAEANAFSVLQHVLGAGPHVKRGSNTTSHLHQAVAKATQQPFDVSAFNASYSDSGLFGIYTISQATAAGDVIKAAYNQVKTIAQGNLSNTDVQAAKNKLKAGYLMSVESSECFLEEVGSQALVAGSYMPPSTVLQQIDSVANADIINAAKKFVSGQKSMAASGNLGHTPFVDEL
Mostra altro
Homologous gene and protein info.
SpeciesGene IDGene SymbolNomeCodice fiscaleOther Gene IDSorgenti
Chimp468094UQCRC2ubiquinol-cytochrome c reductase core protein 29598VGNC:9404Inparanoid, OMA, EggNOG
Macaque697967UQCRC2ubiquinol-cytochrome c reductase core protein II9544Inparanoid, OMA, EggNOG
Mouse67003Uqcrc2ubiquinol cytochrome c reductase core protein 210090MGI:1914253Inparanoid, OMA, EggNOG
Rat293448Uqcrc2ubiquinol cytochrome c reductase core protein 210116RGD:1359150Inparanoid, OMA, EggNOG
Dog479815UQCRC2ubiquinol-cytochrome c reductase core protein 29615VGNC:48164Inparanoid, OMA, EggNOG
Horse100057847UQCRC2ubiquinol-cytochrome c reductase core protein 29796VGNC:24818Inparanoid, OMA, EggNOG
Cow282394UQCRC2ubiquinol-cytochrome c reductase core protein 29913VGNC:36696Inparanoid, OMA, EggNOG
Pig100524613LOC100524613cytochrome b-c1 complex subunit 2, mitochondrial9823OMA, EggNOG
Opossum100026672LOC100026672cytochrome b-c1 complex subunit 2, mitochondrial13616OMA, EggNOG
Platypus100077249LOC100077249cytochrome b-c1 complex subunit 2, mitochondrial9258OMA, EggNOG
Chicken427009UQCRC2ubiquinol-cytochrome c reductase core protein II9031CGNC:1783Inparanoid, OMA, EggNOG
Anole lizard100568017LOC100568017cytochrome b-c1 complex subunit 2, mitochondrial28377OMA, EggNOG
Xenopus549420uqcrc2ubiquinol-cytochrome c reductase core protein 28364XB-GENE-976155Inparanoid, OMA, EggNOG
Zebrafish322549uqcrc2bubiquinol-cytochrome c reductase core protein 2b7955ZDB-GENE-030131-1269Inparanoid, OMA
Zebrafish436930uqcrc2aubiquinol-cytochrome c reductase core protein 2a7955ZDB-GENE-040718-405OMA, EggNOG
C. elegans181374ucr-2.1Ubiquinol-Cytochrome c oxidoReductase complex6239Inparanoid, OMA

Associated Recombinant Proteins

NomeSpecification and purityExpression systemProtein labelDisponibilitàVedi dettagli

Associated Antibodies

NomeSpecificationsSpecies reactivityApplicazioneDisponibilitàVedi dettagli

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NomeDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.